(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE146

ACCPU_3.PE146        Location/Qualifiers
FT   CDS_pept        complement(155384..156187)
FT                   /locus_tag="CAP2UW1_4724"
FT                   /gene_family="HOG000219250" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbJ"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091651"
FT                   /db_xref="GeneID:8402086"
FT                   /translation="MKVLTSKPAATKLTATGTLLRALLLALFAGPAMTTPTHAAGIPVI
FT                   DTANLSQTVISSIEAVAQTLKQIQQYQTQLQQYENMLQNTLAPAAYIWDSATSTMNQLR
FT                   SAIDTLNYYKTNLGSIDAYLGKFQDASYYRGSPCFRQGGCTDAEWAAIKENQRLGSEAQ
FT                   KRATDALFRGLDKQQAALEADAMTLQRLQASAQGATGQMQAISYANQLASQQANQLLQI
FT                   RALLVAEQNAIATRNQVLADREAQQAAAGEQLRQGSYVASPVRNW"
FT                   /protein_id="YP_003165294.1"
     atgaaagtct tgaccagcaa accagccgcc acaaagctaa ctgccacagg caccctgctt        60
     cgggccctgc ttctggccct gttcgccggc ccggcaatga cgacgccgac gcatgcagca       120
     gggatcccgg ttatcgacac cgcgaacctc tcgcagaccg tcatcagctc gatcgaagcg       180
     gtcgcccaga cgctgaagca gattcagcag taccagacgc aactgcagca gtacgaaaac       240
     atgctgcaga acacgctggc gccggcagcc tatatctggg actcggccac cagcacgatg       300
     aaccagctgc gcagtgcgat cgacacgctg aattactaca agaccaacct ggggagcatc       360
     gacgcgtacc tcggcaagtt ccaggatgcg tcctattacc gcggctcgcc ctgcttcagg       420
     caaggcggtt gcaccgacgc ggagtgggcc gcgatcaagg agaaccaacg cctcggctcc       480
     gaagcacaga agagggccac cgatgcgctg ttccgtggcc tcgacaagca acaagccgcc       540
     ctggaagcgg atgccatgac cttgcagcgc ctgcaggcga gcgcgcaggg tgcgactggc       600
     cagatgcagg cgatcagcta cgcgaatcag ctcgccagcc agcaggccaa ccaactgctg       660
     caaatccgcg ccctgctggt ggccgagcag aacgccatcg ccacccgcaa ccaggtgctt       720
     gcggatcggg aagcacaaca agccgctgcc ggcgagcaac tgcgtcaggg gagctacgtc       780
     gccagcccgg tccgtaactg gtaa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page