(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE147

ACCPU_3.PE147        Location/Qualifiers
FT   CDS_pept        complement(156206..157657)
FT                   /locus_tag="CAP2UW1_4725"
FT                   /gene_family="HOG000289491" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbI"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091652"
FT                   /db_xref="GeneID:8402087"
FT                   /translation="MVDQVTEDQMSPEASPGELSRKSGVRRVNNLPVYLVGGVMTVFLA
FT                   IMVLVAADRNAQQNKPNGGPKEKGGNTRLFASEIAGEQKDGIIPPAAAKPLQVPELSPP
FT                   ATTDGAVLIARPDNLDTPPKPPTSAGGGTPQSSSRDEELNRIRMAKMQQLEEAVKAKTT
FT                   VQMVAPRSAGSAPGAAGYAGAPGSREETLARLAALRQQSEAAVHDDPTAAYKARLATLQ
FT                   GAGIGGGGSGAASSSPQLLPSAAAGGRNNVAQFGNGSSGGSSGSSSGDQGDRWKLDSRM
FT                   EAPRSPFELRAGFVIPGTLISGINSQLPGQIMAQVAQNVYDTPTGKHLLIPQGSRLVGR
FT                   YSSDVAYGQARVLVAWQRIVFPDGKAIDIGAMPGADGVGYAGLTDQVNNHYLRLFGSAL
FT                   LMSAVTAGITYSQGQNQGNSVYGAPTASSAMSEALGQQLGQVTAQLIAKNMNIAPTLEI
FT                   RPGYRFNVIVARDMTFSKPYQSFDY"
FT                   /protein_id="YP_003165295.1"
     atggttgacc aagtgaccga agaccagatg tcccccgagg cgtcgcccgg cgaactctcg        60
     agaaaatccg gcgtgcgccg ggtcaataac ctgccggtgt atctcgtcgg cggtgtcatg       120
     accgtgttcc tggccatcat ggtgctggtc gctgcggacc gtaatgccca gcagaacaag       180
     cccaacggcg ggccgaagga gaagggtggc aatacccgcc tgttcgccag cgagatcgcc       240
     ggcgaacaga aggatggaat cattccaccg gcagccgcga agccgctgca agtccccgaa       300
     ctctccccgc ccgcgaccac cgacggcgcc gtgctgattg cacgcccgga caacctcgat       360
     accccgccaa agccaccgac ctcggccggc ggtggcacgc cccagagcag ctcccgtgac       420
     gaagaactga atcgcatccg tatggcgaag atgcagcagc tcgaagaagc ggtgaaggcc       480
     aaaaccacgg tgcagatggt tgccccgcgc agcgccggct cggcgcccgg cgctgcgggc       540
     tatgccggcg caccgggtag ccgggaggaa acactggcgc gcctggcagc cctacggcaa       600
     cagagcgagg ccgcggtgca cgacgacccg acggcagcct acaaggcccg gctggcgaca       660
     ctgcagggtg ccggcatcgg gggcggcggc agcggtgccg cctcgtcgtc tccccagttg       720
     ctgccctcag cggccgcggg cggcaggaac aacgtcgcgc aattcggaaa tggcagcagc       780
     gggggcagca gcggcagcag cagcggcgac cagggcgatc gctggaagct ggattcccgg       840
     atggaagcgc cgcgctcgcc gtttgagctg cgggctggct tcgtcatccc gggaacgctg       900
     atctccggga tcaactccca actaccgggc cagatcatgg cccaggtcgc gcagaatgtg       960
     tacgacacgc caaccggcaa acatctgttg atcccgcaag gctcgcgcct ggtcggccga      1020
     tactcgagtg atgtcgccta cggccaggcg cgcgtgctcg tcgcctggca acgcatcgtc      1080
     ttccccgatg gcaaggcgat cgatatcggc gccatgccgg gcgccgatgg tgtcggctat      1140
     gctggcctta cggaccaggt gaacaatcat tacctgcgcc tgttcggatc agccctcctg      1200
     atgtctgccg tgaccgccgg catcacctac agccagggcc agaaccaggg caacagtgtc      1260
     tatggcgcac cgaccgccag cagcgcgatg agcgaagccc tgggccagca gctcggccaa      1320
     gtgaccgcgc agttgatcgc caagaacatg aacatcgcac cgacgctcga gatccggccg      1380
     gggtatcgct tcaacgtcat tgtcgccagg gacatgacgt tctccaagcc gtaccaatcg      1440
     tttgactact ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page