(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE148

ACCPU_3.PE148        Location/Qualifiers
FT   CDS_pept        complement(157664..158125)
FT                   /locus_tag="CAP2UW1_4726"
FT                   /gene_family="HOG000229816" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbH"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091653"
FT                   /db_xref="GeneID:8402088"
FT                   /translation="MRQFALSALLVMALAGCASTAPYGNFATEPPAGLEERIATDTVKQ
FT                   LVTLYPPARTRFHLGQPTPDAYGSALVEALRAKGYALVEFKPGTAPQAGSPEAAAATAP
FT                   GLNLHYLLDTAASPNLYRITVMVGQQSLSRAYLAQNDRVAPAGAWVRKE"
FT                   /protein_id="YP_003165296.1"
     atgcgccagt tcgccctctc cgcgctcctg gtgatggctc tggccggttg tgcgtcgacc        60
     gcgccctacg gcaacttcgc gaccgagccc ccagccggcc tggaggaaag gattgccacc       120
     gacacggtca agcagctggt caccctgtac ccgccggcaa gaacgcgctt ccatcttggc       180
     cagccgacgc cggatgccta tggcagcgcc ctggtggaag cactgcgggc gaagggctat       240
     gcgctcgtgg agttcaagcc gggaacggcc ccgcaggcag gctctccgga agccgcagcg       300
     gcgactgcgc cagggctgaa cctgcactac ctgctcgaca cagcggccag tccgaacctt       360
     taccggatca ccgtgatggt cgggcagcaa tcgctcagcc gcgcctacct ggcacagaac       420
     gaccgcgtgg cgccggccgg tgcctgggtt cgcaaggagt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page