(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE149

ACCPU_3.PE149        Location/Qualifiers
FT   CDS_pept        complement(159032..159805)
FT                   /locus_tag="CAP2UW1_4728"
FT                   /gene_family="HOG000289469" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbF"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091654"
FT                   /db_xref="GeneID:8402108"
FT                   /translation="MNFADPLKRLIGRKPAADADRQSAKEPTTWGFRQDESENPYLAAR
FT                   RTWNEHVGGVVSSRQTWQVIGILSLLIALAGVGGIIHIGSQSKFVPYVVQVDRLGQAVA
FT                   VAPADRATPADARVIEASVASFIADARLVTPDVALQRKAVFRVYSMLAPNDPATARMNE
FT                   WLNGAEDSSPFKRAAKETVSIEIASVLPQTPETWQVDWVETSRDRQGILKGQPFRMRAL
FT                   VTVYVAEPTPSTSEEQIRNNPIGLYVRDFSWAKQL"
FT                   /protein_id="YP_003165297.1"
     atgaacttcg cagacccact caagcgcctg atcggccgaa agcccgcagc ggacgccgat        60
     cgccaaagcg ccaaagaacc gacgacctgg ggtttccgcc aggacgaaag cgagaacccc       120
     tacctggccg ctcgtcggac ctggaacgaa catgtcggcg gcgtcgtgtc gtcgcgccag       180
     acctggcagg tgatcggcat cctgtcgctg ttgatcgcgc tggcgggtgt cggcggcatc       240
     atccacatcg gcagccaatc gaaattcgtg ccgtatgtcg tccaggtcga ccggctcggg       300
     caggccgtgg ccgtggcgcc ggccgatcgc gccacaccgg ccgatgcccg ggtgatcgaa       360
     gcgtcggtgg cttccttcat cgccgacgcg cgcctggtaa cacccgacgt ggccctgcag       420
     cgcaaggcgg tgttccgcgt gtactcgatg ctcgcaccga acgacccggc cacggccagg       480
     atgaacgaat ggctgaacgg cgccgaagac tccagcccgt tcaagcgggc cgccaaggag       540
     acggtcagca tcgagatcgc ctcggtgctg ccgcaaacgc cggaaacctg gcaggtcgac       600
     tgggtcgaga ccagccgcga ccgccagggg atcctgaagg gccagccctt ccgcatgcgt       660
     gccctggtga cggtctatgt cgccgaaccg acccccagca ccagcgaaga acagattcgc       720
     aacaatccga tcggcctgta cgtccgtgac ttctcctggg cgaagcagct ctaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page