(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE15

ACCPU_3.PE15         Location/Qualifiers
FT   CDS_pept        13310..13576
FT                   /locus_tag="CAP2UW1_4583"
FT                   /gene_family="HOG000100497" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091520"
FT                   /db_xref="GeneID:8401955"
FT                   /translation="MRTTKTLSITLPPEMLARAAEIARREHRTMSELVREALRDYERKN
FT                   WWSEMNAFGQAKAAELGLTEADVDQAVHEVRRERAGRGPETKV"
FT                   /protein_id="YP_003165163.1"
     ATGCGAACGA CCAAAACTCT CTCGATCACT CTGCCGCCGG AAATGCTCGC CCGAGCCGCG        60
     GAGATCGCCC GGCGCGAACA CCGCACGATG AGCGAGCTGG TGCGCGAAGC CCTGCGTGAC       120
     TATGAGCGCA AGAATTGGTG GTCTGAAATG AATGCCTTCG GCCAGGCGAA AGCTGCCGAA       180
     CTTGGCCTGA CCGAGGCCGA TGTTGACCAG GCTGTGCACG AAGTGCGTCG CGAGCGCGCT       240
     GGCCGCGGTC CCGAGACCAA GGTGTGA                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page