(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE150

ACCPU_3.PE150        Location/Qualifiers
FT   CDS_pept        complement(159802..162360)
FT                   /locus_tag="CAP2UW1_4729"
FT                   /gene_family="HOG000289436" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbE"
FT                   /transl_table="11"
FT                   /note="type IV secretion system ATPase VirB4 family"
FT                   /db_xref="GI:257091655"
FT                   /db_xref="GeneID:8402090"
FT                   /translation="MIAGIAFAIATLGALLLLVLYARIRAVDEELKLKKHRSRDAGLAD
FT                   LLNYAAMVDDGVMVGKNGAFLAAWLYKGADNASSTDEQREIVSLRINQALSGLGNGWMV
FT                   HVDAARLPAPNYLDRGTSHFPDGVSAAIDEERRQLFEGLGTLYEGYYVLTLTWFPALLA
FT                   QRKFVELMFDDDAKAPDHKAHTHGLIEFFKRECVSIESRLSSAVELQRLRGHQVVNEDG
FT                   SAVTHDDFLRWLQFCVTGVNHPVQLPSNPMYLDALIGGQELWTGVVPKVGRKFIQVVAI
FT                   EGFPLESTPGMLTALGELACEYRWSSRFIFMDTHEAVRHLDKFRKKWRQKIRGFFDQVF
FT                   NTHLGPIDQDALSMVADAEAAIAEVNSGLVAQGYYTSVVVLMDEDRSRLEASARQVEKA
FT                   VNRLGFAARIETLNTMDAYLGSLPGHGVENVRRPLINTMNLADLLPTSTIWTGSNAAPC
FT                   PMYPPLAPALMHCVTHGATPFRLNLHVRDLGHTFLFGPTGSGKSTHLGILAAQLRRYAG
FT                   MSIFAFDKGMAMYPLAAAIRAQTQGRSGRHFTVAADDDQLAFCPLQFLETKGDRAWAME
FT                   WIDTLLALNDLHTTPAQRNEIGHAILSLHASGGRTLSEFSVTIQDEAIRDAIRQYTVDG
FT                   AMGHLLDAEEDGLSFSDFTVFEIDELMNLGEKYALPVLLYLFRRIERALHGQPAVIMLD
FT                   EAWLMLGHPAFRAKIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLP
FT                   NLYARDEDTAALYRRMGLNTRQIEILATAIPKRQYYYVSENGRRLYDLALGPLALAFVG
FT                   ASDKESLATIQHLESKLGDGWVHEWLAGRGLTLDTYGVAA"
FT                   /protein_id="YP_003165298.1"
     atgatcgccg gaattgcctt cgccattgcc accctcggcg ccttgctgct gctcgtgctt        60
     tacgcccgca tccgtgcggt cgacgaggaa ctgaagctca aaaagcatcg ctcgcgggat       120
     gccgggctgg ccgacctgct caactacgcc gcgatggtcg acgacggcgt gatggtgggc       180
     aaaaacggcg ccttcctggc tgcctggctg tacaagggcg ccgacaacgc cagcagcacc       240
     gacgagcaac gcgagatcgt ctcgttgcgc atcaaccagg cgctctccgg tctcggcaat       300
     ggctggatgg tgcacgtgga cgcagcgcgg ctgccagcac ccaactatct cgatcgtggc       360
     acctcccact ttcccgacgg ggtgtcggca gcgatcgacg aggagcggcg gcaactgttc       420
     gagggtctgg gcaccctcta cgaaggctac tatgtgctga cgctgacctg gttcccggcg       480
     ctgctcgcgc agcgcaagtt cgtcgagctg atgttcgacg atgacgccaa ggcacccgac       540
     cacaaggcgc acacccacgg cttgatcgag ttcttcaagc gcgagtgcgt cagcatcgag       600
     tcgcggctgt cgtcggcggt ggagctgcag cggctacgcg gccaccaggt ggtcaacgag       660
     gacggttcgg cagtcaccca cgatgacttc ctgcgctggc tgcagttctg cgtcaccggc       720
     gtgaatcatc cggtgcagtt gccgagcaac ccgatgtacc tggacgcgct catcggtggg       780
     caggaactgt ggaccggcgt cgtgccgaag gtcggccgca agttcatcca ggtcgtcgcc       840
     atcgaaggct tcccgctgga atcgacgccg ggcatgttga ccgccctcgg tgagctggcc       900
     tgcgaatatc gctggtcgtc gcgtttcatc ttcatggata cgcacgaggc ggtaagacac       960
     ctcgacaagt tccgcaagaa atggcggcag aagattcgcg gcttcttcga ccaggtcttc      1020
     aacacccacc tcgggccgat cgatcaggac gcgctgtcga tggtcgccga tgccgaagcg      1080
     gcgattgccg aagtcaatag cggcctagtc gcgcaaggct actacaccag cgttgtcgtg      1140
     ctcatggacg aggatcgcag ccgcctggaa gcgtctgccc gccaggtgga aaaggccgtc      1200
     aaccgcctcg gcttcgccgc ccgcatcgag accctcaaca ccatggacgc ctacctcggc      1260
     agcctgcccg gccacggcgt ggaaaacgtc cgccggccgc tgatcaacac catgaacctg      1320
     gccgatctgc tgccgacgag caccatctgg accggcagca acgctgcccc ctgcccgatg      1380
     tacccgccac tcgcgccggc gctgatgcac tgcgtcaccc acggcgcgac accgttccgc      1440
     ctgaacctgc acgtgcgcga ccttggccat accttcctgt tcggcccgac cggctccggc      1500
     aagtcgaccc acctcggcat cctcgctgcg cagcttcgcc gctacgccgg catgtcgatc      1560
     tttgccttcg acaagggcat ggcgatgtat ccgctcgctg ccgccatccg cgcccagacc      1620
     cagggtcgca gcggccggca cttcacggtg gcggccgacg acgatcagtt ggccttctgc      1680
     ccgctgcagt tcctcgaaac caagggcgac cgcgcctggg cgatggagtg gatcgacacc      1740
     ctcctcgcct tgaacgacct gcacaccacg ccggcgcagc gcaacgagat cggccatgcg      1800
     atcctcagtc tgcacgccag cggcggccgc accctgtcgg aattctcggt caccatccag      1860
     gacgaagcga tccgcgacgc gatccgtcaa tacaccgttg atggtgccat ggggcacctg      1920
     ctggacgccg aagaagacgg cttgtcgttc tccgatttca ccgtcttcga aatcgacgaa      1980
     ttgatgaacc tcggcgagaa gtacgcgctg ccggtactgc tctatctctt ccgacgcatc      2040
     gagcgcgccc tgcacggcca gccggccgtg atcatgctcg acgaggcgtg gttgatgctc      2100
     gggcacccgg cctttcgcgc caagatccgc gagtggctca aggtcttgcg caaggccaac      2160
     tgcctggtgc tgatggccac gcaaagtctt tccgacgccg ccaattcagg cattctggat      2220
     gtgatcgtcg aatcgaccgc gaccaagatc ttcctgccca acctctatgc ccgcgacgag      2280
     gacacggccg ccctctaccg ccgcatgggc ctcaacaccc ggcagatcga gattctggcg      2340
     acagccattc ccaagcgcca gtactactac gtctcggaga acggccgccg cctgtacgac      2400
     ctcgccctcg gccccctggc gctcgccttc gtcggcgcct ccgacaagga gtcgctggcc      2460
     accatccagc acctggagag caagctgggc gatggctggg tgcacgagtg gctggccggg      2520
     cggggattga cgctggacac ctatggagtc gccgcatga                             2559
//

If you have problems or comments...

PBIL Back to PBIL home page