(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE151

ACCPU_3.PE151        Location/Qualifiers
FT   CDS_pept        complement(162357..162668)
FT                   /locus_tag="CAP2UW1_4730"
FT                   /gene_family="HOG000289425" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbD"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091656"
FT                   /db_xref="GeneID:8402091"
FT                   /translation="MALRKIPIRRAGNRDNLFMGGDRELVMFSGLLAFALVFSAQELRA
FT                   TVVGLLLWFGALYALRIMAKADPRMRHVYLRHRRYKPYYPARSTPFRDNTTSQGKQYQ"
FT                   /protein_id="YP_003165299.1"
     atggcgctgc gcaagatccc cattcggcgg gccggtaatc gggacaacct gttcatgggc        60
     ggcgatcgtg aactggtcat gttctcgggt ctgctggctt tcgcgctggt cttcagcgca       120
     caggagctgc gggccacggt cgtcgggctg ctgctctggt tcggcgcgct ctacgcgctg       180
     cggatcatgg ccaaggcaga cccccggatg cgccacgtgt acctgcggca ccggcgctac       240
     aagccgtact acccggcgcg cagcacgccc ttccgggaca acacgaccag ccaggggaag       300
     cagtaccaat ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page