(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE152

ACCPU_3.PE152        Location/Qualifiers
FT   CDS_pept        complement(162671..163093)
FT                   /locus_tag="CAP2UW1_4731"
FT                   /gene_family="HOG000289414" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbC"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091657"
FT                   /db_xref="GeneID:8402092"
FT                   /translation="MHSPALPYPLARSTLFYCGLAILLLVFLLVPQHALAAEGTGGSLP
FT                   YESWLTNLRNSVTGPVAFALAMIGIVVAGGVLIFGGDLNGFFRTLIFVVLVMALLVGAQ
FT                   NMMSSFFGRGAEIAALGAGGFDPVQLAGGIAPGRLA"
FT                   /protein_id="YP_003165300.1"
     atgcactcgc ccgccctccc ctacccgctc gcccgttcga ctctgttcta ttgcggactg        60
     gcgatcctcc tgctggtgtt cttgctggtc ccgcaacacg ccctggcagc ggaaggcacc       120
     ggcgggtcgc tgccctatga aagctggctg accaacctcc gcaactcggt caccggcccg       180
     gtggcgttcg cactggcgat gatcggcatc gtcgttgcgg gtggcgtgct gatcttcggt       240
     ggcgatctga acggcttctt ccgcaccttg atcttcgtcg ttctcgtcat ggccctgctg       300
     gttggcgcgc aaaacatgat gagcagcttc ttcggccgtg gcgcagaaat cgccgccctc       360
     ggtgcaggcg ggttcgaccc ggtccagctt gccggcggga tcgctccggg aaggctcgcc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page