(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE155

ACCPU_3.PE155        Location/Qualifiers
FT   CDS_pept        complement(165190..166233)
FT                   /locus_tag="CAP2UW1_4734"
FT                   /gene_family="HOG000097665" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091660"
FT                   /db_xref="GeneID:8402095"
FT                   /translation="MLIPPDYAAWLAELKTTIRTARLKAGLAVNRELVLLYWRIGKEIL
FT                   ERQSAQGWGAKVIDQLARDLRAEFSDMRGFSRTNLLYMRAFASAWPEEAIVHQLGGQIP
FT                   WRHNCVIIDQAKDRPTREWYIRKTIENGWSRSVLELQIETAAHRRVGAAQTNFDRALPS
FT                   PQSDLARDILKDPYTFDFLGITDASNERTIEKALVLRLRDFLIELGVGFAFVGSQYRLE
FT                   VDGDEFFMDLLFYHTRLHCYVVIELKNTAFRPEYVGKLNFYLAAVDELVRNQTVDAPTI
FT                   GLVLCKSKKGTVVEYALRDIHAPMGVSTYRTALPDAMAGVLPSIEALTEELQALQGGEH
FT                   DDLEPDQ"
FT                   /protein_id="YP_003165303.1"
     ttgctcatcc ctcccgacta cgccgcatgg ctggcggagt tgaagaccac catccgcacg        60
     gcgagactca aggccgggct cgccgttaac cgggaactgg tcctgctcta ttggcgtatc       120
     ggcaaggaga ttctcgaacg ccaatccgcc cagggctggg gggcgaaggt catcgaccaa       180
     ctggcccgcg acctccgtgc cgagttctcc gacatgagag gtttttcccg caccaatctg       240
     ctctacatgc gggcatttgc ctcagcgtgg ccagaggaag caattgtcca ccagcttggt       300
     ggacaaattc catggcggca caactgcgtc atcatcgacc aggccaaaga ccgtccgacc       360
     cgcgagtggt acatccgcaa gaccatcgaa aacggctgga gccggtcggt gctcgaactc       420
     cagatcgaga cggccgcgca ccggcgcgtg ggcgccgcgc aaaccaactt cgatcgtgcg       480
     ctgccgtcgc cacagtcgga cttggcacgc gacatcctca aggaccccta caccttcgac       540
     ttcctcggga tcacggatgc gtcaaacgag cgcaccatcg aaaaggcgct cgtgctgcgc       600
     ctgcgagatt tcctgatcga actcggcgtc ggtttcgcgt ttgtgggaag tcagtaccgt       660
     cttgaggtgg acggcgacga gttcttcatg gacttgcttt tctatcacac ccgcctgcac       720
     tgctacgtgg tgatcgagct caagaatacc gccttccggc ccgagtacgt cggcaaactc       780
     aatttctacc tcgccgccgt cgatgagctg gtgcgcaacc agactgtcga tgcgccaacg       840
     atcggtctcg tgctctgcaa gagcaagaaa ggaacggtcg ttgagtatgc gctccgagac       900
     atccatgcgc cgatgggggt ctccacctac cgcaccgccc tgcctgatgc catggcgggc       960
     gtcctgccga gcatcgaggc gctgacggaa gaactgcaag cgctccaggg cggcgaacac      1020
     gacgatctcg aacccgatca gtga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page