(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE156

ACCPU_3.PE156        Location/Qualifiers
FT   CDS_pept        complement(166246..167226)
FT                   /locus_tag="CAP2UW1_4735"
FT                   /gene_family="HOG000130877" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091661"
FT                   /db_xref="GeneID:8402096"
FT                   /translation="MNVPELIFPGIDVAKDTLELALDDQSKTECIANSGKEIGALVNRL
FT                   KLLAERIGVILLEATGGYERPVAAALCAAGLPVMVVNPRQARDFAKSMGYLAKTDAIDA
FT                   RVLSHFGRTLHQSAQRERLLMKLPDANQEALEALLVRHNQLVAMRVAEANRLATSHPSQ
FT                   HKSIKLVLKMLDRQIALIDKNIDGMLKGHFAQKLALFKDFKGVGPCMQAALMGALPELG
FT                   QLTHAQIGKLVGVAPLNADSGRHKGKRITWGGRATVRTTLYMAALSAIRYNPVIKIFYE
FT                   RLLAKGKLKKVALVACMHKMLTIMNAIVKSGIPWNPEHPNAPKNA"
FT                   /protein_id="YP_003165304.1"
     atgaacgttc cggaattgat tttccccggc attgatgttg cgaaagacac gctcgaactt        60
     gctctggacg accagtccaa gaccgaatgc atcgccaaca gcgggaagga gatcggagcc       120
     ttggtgaacc ggctgaagct gcttgcggag cgaattggcg tgatcctgtt ggaggccacg       180
     ggtggctatg agcgcccagt ggcagcggcg ctctgtgcgg ccggtctgcc ggtgatggtg       240
     gtgaatccac ggcaggcgag ggatttcgcg aaatcaatgg gatacctcgc caagacggac       300
     gccattgatg cgcgagtgct ctcgcacttt gggagaacgc tgcaccagtc cgcgcagcgg       360
     gagcggctgt tgatgaaact gcccgacgcc aaccaggagg cactggaagc cttgctggtg       420
     cgccacaacc agttggtcgc catgcgcgtg gcggaggcaa accgcttggc cacgagccat       480
     ccgtcgcagc acaaaagcat caagctggta ctcaagatgc tcgatcggca gattgcgctg       540
     attgacaaga acatcgatgg catgttgaag ggacattttg ctcagaagct cgcgttgttc       600
     aaggatttca aaggagtcgg gccctgcatg caagcggctc tgatgggcgc cttgcctgag       660
     ttggggcaac tcacccatgc gcaaattggc aagctggtcg gcgtggctcc cttgaacgcg       720
     gacagcggtc gccacaaggg caagcgcatc acctgggggg gtcgcgcgac agtgcgtacc       780
     actttataca tggcggccct gagcgccata cggtacaacc cggtgatcaa gatcttctac       840
     gaacggttgc tcgccaaagg caagctcaaa aaggtcgcct tggtcgcttg catgcataag       900
     atgctgacga ttatgaacgc gatcgtcaaa tcgggtatcc cctggaatcc agaacaccca       960
     aacgccccta aaaacgcttg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page