(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE16

ACCPU_3.PE16         Location/Qualifiers
FT   CDS_pept        13573..14001
FT                   /locus_tag="CAP2UW1_4584"
FT                   /gene_family="HOG000262558" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091521"
FT                   /db_xref="GeneID:8401956"
FT                   /translation="MTVVVADTSVYVSALVFGGVPQAALIKAITTPFRVAISHALKAEL
FT                   VETLERKFAWPSSRVAHACAHLWGGAIWCEPVAVQASRDPDDDHVLGCAIAASANVLVT
FT                   GDKDLLSLHPFRGIAIVTPATFLAMPWTVHGDDRAPFV"
FT                   /protein_id="YP_003165164.1"
     GTGACGGTCG TCGTTGCCGA TACGAGCGTC TATGTTTCGG CGCTCGTGTT CGGTGGTGTG        60
     CCGCAGGCCG CCCTCATTAA AGCGATCACC ACCCCCTTCC GCGTCGCGAT CTCCCACGCG       120
     CTGAAGGCCG AACTTGTCGA AACGCTTGAG CGCAAATTTG CCTGGCCTTC TTCTCGGGTG       180
     GCACATGCCT GCGCACACTT GTGGGGAGGG GCTATCTGGT GCGAGCCGGT TGCCGTTCAA       240
     GCCTCGCGCG ACCCCGATGA CGATCACGTG CTTGGCTGTG CGATCGCCGC TTCAGCCAAC       300
     GTGTTGGTTA CGGGCGACAA GGACCTCCTG TCGTTGCATC CGTTCAGGGG CATTGCCATC       360
     GTGACGCCGG CGACATTTCT GGCGATGCCG TGGACGGTCC ACGGTGACGA CCGAGCACCA       420
     TTCGTTTGA                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page