(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE18

ACCPU_3.PE18         Location/Qualifiers
FT   CDS_pept        complement(14243..14428)
FT                   /locus_tag="CAP2UW1_4586"
FT                   /gene_family="HOG000056421" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091523"
FT                   /db_xref="GeneID:8401958"
FT                   /translation="MAAAKKPGQSTGNQGGIYQEVGPKGGKQPNYTTVADNRPLPPTTK
FT                   PGHGWAPVKVTPNSSR"
FT                   /protein_id="YP_003165166.1"
     atggcagcag cgaagaagcc cggtcagagc accggcaatc agggtgggat ttaccaagag        60
     gttgggccca agggcggcaa acagccgaac tacacaacgg tagcggacaa ccgcccgttg       120
     ccgcccacaa ccaagccagg tcatggctgg gcacccgtga aagtgacccc gaacagcagc       180
     cgctga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page