(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE19

ACCPU_3.PE19         Location/Qualifiers
FT   CDS_pept        complement(14660..17005)
FT                   /locus_tag="CAP2UW1_4587"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091524"
FT                   /db_xref="GeneID:8401959"
FT                   /translation="MADETQRNARNDRLPIKLIMPKQGTERRVLGGGTPPAPFRDVDLQ
FT                   YRNRLSNQIGAIQEALLPQLKMTRAAPVRVKIMSKAAAKSHRPEKLFSDKSCPIIGAGR
FT                   LGELFIKATPTGLEQLTQIIQNNTSDQITKELSCIESIEAVTPASRRHGLGAEDILCRS
FT                   PRRRNGFITRVRLFSFGADDDHPALVANFESVCRERGIKLDQRGYSERSFIYAAECQTV
FT                   ADVEALSRIIGVRSISHMPLVRTIRPRMMNQQALPALPTRDAADADVPVVVVVDGGISD
FT                   QIPALNSWVVGRVRDVSPPYDQNTDHGTFVAGLVCWGRELNPTVGGLDSGACAVFDLQV
FT                   IPNDDPSRGETSALLESELLSSLESALQEHANKYRVWNLSLGTDAICSLDEFSELAEEL
FT                   DNLQEKYQVSFVISAGNYATLPLLDFPRTPGQIEVGRITSPADSVLGITVGSVSHVDYK
FT                   TNGPRQHHPSAFSRHGAGPNYIIKPDLVHYGGSCSTDAAHVHGIRSVTDSGLAEDLGTS
FT                   FATPLVSRTLAQIYHQITPTPSPVLARALLTHHARDPRSGTRVPDGEENFLGFGLPAAV
FT                   PYCLECTPHTATLVFEDTLRPGYFLEWDDFPYPPSLKRNDKYFGEVWMTLAFVPTRGAR
FT                   WGSEYCETHIDAHLGVYRDRVSRTTGEIKRMFAGLVPPEHRNPGLLYEAYQVEKMRKWA
FT                   PVRTYHGRLNENGERGNRWRLMLKLLTRHGIEKDEAAFKPQPFSLIITIADPEKKASVY
FT                   DEVAQIVRNRFQAQNLTIRARARVQGKA"
FT                   /protein_id="YP_003165167.1"
     gtggctgacg agacccaacg gaatgcgcgc aacgatcgcc tgccgatcaa actgatcatg        60
     cccaagcagg gaaccgagcg tcgcgtgctg gggggtggca cgccgccggc gccgtttcgt       120
     gatgttgacc tgcagtaccg caatcggctt tccaaccaga tcggcgccat tcaagaagcc       180
     ctcttgccgc aactcaagat gacgcgggcg gcgccggtac gcgtcaagat catgtcgaag       240
     gcggcggcga agagccaccg accggaaaag ctgttctccg acaagtcgtg tcccatcatc       300
     ggcgcgggcc gccttggcga gctgttcatc aaggcaacgc cgacgggact ggaacagcta       360
     actcaaatca tccagaacaa cacatcggat cagatcacca aggaactctc ctgtatcgaa       420
     agcattgaag cggtgacgcc ggcgtcgcgt cgccatggcc tgggtgccga ggacatcctc       480
     tgtcgcagcc cgcgccgtcg caacgggttc atcacccgcg tccgcttgtt cagtttcggc       540
     gccgatgatg atcacccggc gctggtcgcc aatttcgagt ccgtgtgtag ggaacgcggt       600
     atcaagctcg atcagcgcgg atattcagaa cgtagcttca tctacgcggc ggagtgccaa       660
     accgtcgccg atgtcgaagc gctgtcgcgt atcatcggcg tgcgctccat ctcccacatg       720
     ccgttggtac gcacgatccg gccgcgcatg atgaaccagc aggcccttcc ggcattgcca       780
     acacgggatg ccgccgatgc ggatgttccg gtcgttgtcg tagtggacgg cggcatttcg       840
     gatcagattc cggcgctcaa ctcatgggtg gttggccgtg ttcgggacgt gtcgcccccc       900
     tatgatcaaa acacggatca cggaaccttc gttgccggcc ttgtctgctg gggccgcgag       960
     ctaaatccga cagttggtgg ccttgattcg ggtgcctgcg ccgtgttcga tctgcaggta      1020
     attccgaacg acgatccatc gcggggcgag acatctgcgt tgcttgaatc ggagctgctg      1080
     tcctcgctgg agtcggcgct ccaggagcat gccaacaagt acagggtctg gaacctctct      1140
     ttgggaaccg acgccatttg ctcgctggat gaattttctg agttggctga ggagctggac      1200
     aatctgcagg agaagtacca ggtttctttt gtcatcagcg ccggcaacta cgccacgctg      1260
     ccgctcctgg actttcctcg cactccgggg cagatcgagg tcggccgcat tacatcgccg      1320
     gccgacagcg tattgggcat cacggtcgga tcagtatccc atgtcgatta caaaaccaac      1380
     gggccaagac agcatcaccc ttcggccttc tcgcgtcatg gtgctggccc caattacatc      1440
     atcaagcccg acctggtgca ctacggcgga tcgtgttcga ccgacgccgc gcatgtgcat      1500
     ggtattcggt ccgtcacgga ttccggcctg gcggaagacc ttggcacgag cttcgccacg      1560
     cccttggttt cgcggacgct ggcgcagatt tatcaccaga tcacgccgac cccgtcaccg      1620
     gtgttggctc gggcattgct gacccaccat gcgcgcgacc cccgttcggg cactcgcgtc      1680
     ccggacggcg aggaaaattt ccttggattt ggtctgccgg cggcagtgcc gtattgcctt      1740
     gaatgcacgc cgcacacagc gacgctggtg ttcgaagaca cgcttcggcc cggctatttc      1800
     ctggagtggg atgatttccc ttatccgcca tcgctgaagc ggaacgacaa gtatttcggg      1860
     gaagtttgga tgacgctcgc tttcgtgcca acacggggcg cgcgctgggg ttccgagtat      1920
     tgcgagaccc atatcgacgc tcacctcggc gtctaccgtg accgtgtatc gcgcaccacc      1980
     ggcgagatta aacggatgtt cgcggggctt gtgcctcctg aacaccgcaa ccccggcctg      2040
     ctctatgagg cataccaagt cgaaaagatg cggaagtggg cgccggtgcg cacctatcac      2100
     gggcgtctaa acgaaaatgg cgagcgaggc aaccgctggc gtttgatgtt gaaactgctg      2160
     acacgacacg ggatcgagaa ggatgaagct gcgttcaagc cgcaaccgtt ttcgctgatc      2220
     atcacgatcg ccgacccaga gaaaaaggcg tcggtctacg acgaggtagc gcagatcgtc      2280
     cgaaacaggt tccaggccca gaatctaacg atcagggcgc gcgcgcgcgt gcagggcaag      2340
     gcgtga                                                                 2346
//

If you have problems or comments...

PBIL Back to PBIL home page