(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE2

ACCPU_3.PE2          Location/Qualifiers
FT   CDS_pept        1323..1445
FT                   /locus_tag="CAP2UW1_4569"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091507"
FT                   /db_xref="GeneID:8401942"
FT                   /translation="MPARIQTPKEAGSLLSGYGFAGAAMQLSAIGMVSTAPATG"
FT                   /protein_id="YP_003165150.1"
     ATGCCCGCGA GGATCCAGAC GCCGAAAGAA GCCGGGAGCC TGCTCTCCGG TTACGGGTTT        60
     GCCGGTGCGG CGATGCAATT GTCCGCGATT GGTATGGTAT CGACGGCACC GGCAACGGGT       120
     TAA                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page