(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE20

ACCPU_3.PE20         Location/Qualifiers
FT   CDS_pept        complement(16998..18158)
FT                   /locus_tag="CAP2UW1_4588"
FT                   /gene_family="HOG000058087" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091525"
FT                   /db_xref="GeneID:8401960"
FT                   /translation="MNTDIRFINELVRIVNGALRLDVDKVRNYTAFLAEKLETAGEKSS
FT                   ADRLRKLLEETDNQLRPADVRFSTTLPVDAESRFPLIEHIKLKTLQEPPVQLLQSQWDV
FT                   VNEFVSVAKSYALLDTTELSGALSFLMYGPPGTGKSRVARHIAKEIGLELYVARLDGLI
FT                   SSYLGSTSKNIRALFDFAAKTPCVLFLDEFDAIAKLRGDSQELGELKRVVNSFLQNLDT
FT                   LGRQSIVLAATNHETLLDTAVWRRFTYRLALQLPSSEQREHMWADFIEPIHFSPRDLTV
FT                   LADLSEGFSGSDIREVCARLKRRHFSTGKPIYLKDAFPVLQNLAIGAEDGARFIARLAN
FT                   KEAPDIVEALRERDQRLYSFAMLGELLGLSKATVHRVSKLEGEERG"
FT                   /protein_id="YP_003165168.1"
     atgaataccg atatccgttt cattaatgag cttgttcgta tcgtcaacgg cgcacttcgt        60
     cttgacgtgg acaaggttcg caattacact gcgttcctcg ccgaaaagct tgaaaccgcc       120
     ggcgagaaaa gctcggccga tcggctgcga aagctgctcg aagagaccga caatcagtta       180
     cgcccagccg atgtccgctt ctccacaaca ctgcccgtcg atgcggaaag ccggtttccc       240
     ctcatcgagc acatcaagct gaagacgctg caggagccgc ccgttcaact cttgcagtca       300
     cagtgggatg tggtcaatga attcgtcagc gtagcgaaaa gctacgcctt gcttgatacg       360
     accgagctgt ccggcgcgct gagctttctc atgtatggcc ctccgggcac gggaaaaagc       420
     cgcgtggcgc gccatatcgc caaggagatc ggactagaac tctacgtcgc ccgcctggac       480
     ggcctgatct cgtcctacct cggcagcacg tcgaaaaaca tccgcgcact gttcgacttc       540
     gccgcgaaaa cgccctgcgt gctatttctg gatgagttcg atgcgattgc caagctgcgt       600
     ggcgacagtc aagaattggg tgagctgaag cgggtggtca acagcttcct acagaacctt       660
     gacacgcttg gtcggcaatc aatcgtcctg gctgcaacca atcatgaaac gctgctggac       720
     accgccgtgt ggcgccgctt cacctaccgt ttggcgttgc agctcccttc atcggaacag       780
     cgggaacaca tgtgggccga tttcatcgag cccatccact tctcgccgcg ggaccttacg       840
     gtcctggcag atctgtccga aggtttttcg ggttcggata tccgcgaagt ctgcgctcgc       900
     ctgaagcgtc ggcacttctc tacgggcaaa ccgatctatc tcaaagacgc attcccggtc       960
     ttgcagaacc tggcgattgg ggcggaagac ggcgcgcggt tcattgcgcg gctcgccaac      1020
     aaagaggcgc cggacattgt ggaagcgcta agggaacggg atcaacgctt gtacagcttc      1080
     gccatgcttg gagagctgct ggggctgtcg aaggcaactg tacacagagt gtcgaagctt      1140
     gagggcgaag agcgtggctg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page