(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE21

ACCPU_3.PE21         Location/Qualifiers
FT   CDS_pept        18330..18599
FT                   /locus_tag="CAP2UW1_4589"
FT                   /gene_family="HOG000260299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091526"
FT                   /db_xref="GeneID:8401961"
FT                   /translation="MNVNLTPQIEEMVRRKVASGLYTSASEVVREALRVMDEQGRVRAA
FT                   KLEQLRQDLRDGLDSGEPTPWDPEEIKREGRKRRTARVPAGQDT"
FT                   /protein_id="YP_003165169.1"
     ATGAACGTCA ATCTCACCCC TCAGATTGAG GAAATGGTCC GACGGAAGGT GGCATCCGGC        60
     CTCTACACCT CCGCGAGCGA GGTTGTCCGC GAGGCGCTGC GCGTCATGGA CGAACAGGGC       120
     CGCGTGCGGG CAGCCAAGCT CGAACAGTTG CGGCAGGATC TCCGCGACGG CCTCGATAGC       180
     GGCGAGCCAA CGCCATGGGA CCCCGAGGAA ATCAAACGCG AAGGCCGCAA GAGAAGAACC       240
     GCGCGCGTTC CTGCCGGCCA AGATACGTAA                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page