(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE23

ACCPU_3.PE23         Location/Qualifiers
FT   CDS_pept        complement(18964..22257)
FT                   /locus_tag="CAP2UW1_4591"
FT                   /gene_family="HOG000055008" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091528"
FT                   /db_xref="GeneID:8401963"
FT                   /translation="MPLLTDFDWQSKYDHDHGSLIEQFYLRALACAQRYDRTTGYFTAT
FT                   ALAIAARGLEGLVLNNGRMRLVVGCTLDEPEVAAIEHGQSLKDTVEGRLLKMPLAGSSP
FT                   REQQALELLAWMVARGYLEIKVAVPCDDDRNPVATQAIFHEKAGILEDKTGARLAFAGS
FT                   VNETAYGWLHNWESFHVFCDWDGGAGHVDAEEKSFALLWADRARRARVLDVPAAVREEL
FT                   LRFLPREADEPERVKRARNGDAVRDSTADDETDQRRSTPQATSVDERRKAVWQLIWSAP
FT                   RQPGGERIAEATSAVTPWPHQILTFQRMLDHWPPRLLIADEVGLGKTIEAGLVLRYAWL
FT                   SGRAQRILIMAPKAVMTQWQAELREKFNLNWPIYDGKRLSWYPSPLLRGKSEKEVARDE
FT                   WHREPFVIVSSHLMRRRDRQNELLEVADPWDLIVLDESHHARRKSPGAAQEGPPNLLLK
FT                   LMQRLKERTDGLLLLTATPMQVHPVEVWDLLSLLAMPPAWSRQGFLEFFRKSGSGNPSH
FT                   EDFEFLAALFRAAEAAFGEVSIESAVRRAPERSLLKAKRILRSLRDAAATPRRQLSAEE
FT                   RRSAVAIMRAHTPVAGLVSRHTRGLLREYHRRGLLSTPIATREVVDEFLDMAPAEAAVY
FT                   DALEAYISTTYNNAQEERRTAVGFVMTTYRKRLSSSFHALKMTLEERLAVVRGQAGLPF
FT                   DELRSSEDAEDDIDESGDAADEEAVDRQKQAALQLEEQGDIETLLEQARRLPVDTKAVR
FT                   LAEVLQALQRGSYHAMDDSLLPAFPQAIVFTQYTDTLDYLRDFLKTQGFSVLCYSGRGG
FT                   EWLQPDGSWKRLTREETKRRFKRQDAQVLVCTDAAAEGLNFQFCGALVNFDSPWNPMRI
FT                   EQRIGRVDRLGQQFPRIAIVNLMYEDTVETDVYRALRSRISLFTSVVGPLQPILSAMPA
FT                   RIAEVALMRPENQQQARANLVSELQQAASQTPADSFNIDEAIEAALEEPERAPAPYGLE
FT                   ELGHLLDHPKLLPPGVEAQRVGTKEVFWTQPGAPRISVTTDPDFFEEHPESVEFWTPGS
FT                   PAFPEDSGSGVQSADGETLATLIRATRDLSSRLSNRTTECALQSVNAVL"
FT                   /protein_id="YP_003165171.1"
     atgcccttgc tgaccgactt cgactggcaa agcaaatacg accacgacca tggctcgctg        60
     atcgagcagt tctatctgcg cgcactcgcc tgcgctcagc gctacgatcg gaccaccggc       120
     tatttcacgg cgaccgcgct ggcgatagcg gcgcgcggcc tggaaggcct ggtgctgaac       180
     aacggccgga tgcgcctggt ggtcggttgc acgctcgatg agcccgaggt ggcggccatc       240
     gagcacggcc agtcactgaa ggacaccgtc gaaggccggt tattgaagat gccgctcgcc       300
     ggcagttcgc caagggaaca acaggcgctg gaactgttgg cgtggatggt ggccaggggc       360
     tacctcgaaa tcaaggtcgc cgttccctgc gacgacgatc gcaacccggt agccacgcag       420
     gccattttcc acgagaaggc cggcatcctc gaagacaaga ccggcgccag gctggctttc       480
     gccggcagcg tgaacgaaac cgcctacggc tggctgcaca actgggagag tttccatgtc       540
     ttctgcgact gggacggcgg cgccgggcac gtggacgcgg aagagaagag ttttgccctg       600
     ctctgggcag accgggccag gcgcgcacgg gtactcgatg tacccgccgc ggtgcgcgaa       660
     gagttgctac gctttctccc gcgcgaagcc gatgaaccgg aacgggtcaa gcgcgctcga       720
     aatggcgacg ctgttcgaga ttcaaccgcc gatgacgaaa cggaccaacg gagaagcacg       780
     ccgcaggcca cttccgtcga cgagcgacgg aaggcggtgt ggcaactgat ctggtctgca       840
     ccgcggcagc ccggtggcga gcgtattgcc gaagcaacca gcgccgtgac cccctggccg       900
     catcagattc tgacctttca gcgcatgctc gaccactggc cgccccgtct gctgattgcc       960
     gatgaagtgg ggctgggcaa gaccatcgag gccggactcg tgttgcgcta cgcgtggctt      1020
     tccgggcgcg cgcagcgcat cctgatcatg gcacccaagg cggtgatgac gcagtggcaa      1080
     gccgagttgc gcgagaagtt caacctcaac tggccgatct atgacggcaa gcgcctgagc      1140
     tggtatccct cgccgctgct gcgggggaaa tcggaaaagg aagtcgcgcg cgacgagtgg      1200
     catcgcgagc ctttcgtcat tgtctccagc cacctgatgc gccggcgcga ccgccagaac      1260
     gaactgctcg aagtggccga cccgtgggat ctcatcgttc tcgacgagtc gcatcatgcg      1320
     cgccgcaaga gcccgggcgc cgcgcaggaa ggcccgccca atcttctgct gaagctgatg      1380
     cagcgtctca aggagcgcac cgacggcttg ctcctgctga ccgcgacacc gatgcaggtg      1440
     catccggtcg aggtctggga cctgctttcg ttgctggcca tgccgccggc ctggtcccgg      1500
     cagggcttcc tcgaattttt ccggaagtcg ggcagcggca atccgtcgca cgaggatttc      1560
     gagtttctcg ctgccctctt tcgcgcggcc gaagccgctt ttggcgaggt gtcgatcgag      1620
     tcagccgtgc gccgagcgcc tgagcgcagt ctgctcaagg cgaaacgcat cctgcgctcg      1680
     ctgcgcgacg ccgccgcgac acccaggcgg cagctttccg cagaagagcg ccgcagtgcg      1740
     gtggccatca tgcgcgcaca cacgccggtg gctggtctgg tatcacggca cacgcgcggc      1800
     cttctgcgcg agtatcaccg gcgcggcctg ctcagcaccc cgatcgccac gcgcgaggtc      1860
     gtcgacgagt tcctcgacat ggcgccggcc gaggctgcgg tctacgatgc gctggaagcc      1920
     tacatctcga cgacctacaa caatgcccag gaggagcggc gcacggcggt cggcttcgtc      1980
     atgacgacgt atcgcaaacg cctctcctcc agctttcatg ccctgaagat gactcttgaa      2040
     gagcgtcttg cggtggtgcg aggacaggcc ggcctgccct tcgacgaact acgttcaagc      2100
     gaggacgccg aagacgacat cgacgagtcc ggcgacgcgg ccgacgagga ggccgtcgac      2160
     cggcagaaac aggctgcgtt gcaactcgaa gaacagggcg acatcgagac tttgcttgag      2220
     caggcgcgca gactaccggt ggacacgaaa gccgtgcggc tcgccgaggt gctccaggcc      2280
     ctgcaaagag gcagctatca cgccatggac gattcgctgc tgcccgcctt tccgcaggcg      2340
     atcgtgttca cccaatacac cgacacgctc gattacctgc gcgattttct caagacacag      2400
     ggattctcgg ttctctgcta ctcggggcgt ggcggcgaat ggctacaacc cgacggcagt      2460
     tggaaaaggc tgacccgcga ggagacgaaa cggcgcttca agcgacagga tgcgcaggtc      2520
     ctggtgtgca ccgatgctgc cgcagagggt ctgaacttcc agttctgcgg cgcgctcgtc      2580
     aatttcgatt cgccctggaa cccgatgcgc atcgagcaac gcatcggacg cgtcgaccgc      2640
     cttggccagc agttcccgcg catcgcgatc gtgaacctga tgtacgagga caccgtcgag      2700
     accgacgtct accgtgcgct gagatcgcgc atcagtctct tcacctcggt cgtcggcccg      2760
     ttgcaaccga ttctctcggc gatgcctgcc cggatcgccg aagtcgccct gatgagacct      2820
     gagaaccagc aacaggccag ggcgaatctt gtcagtgagc ttcagcaggc ggccagccag      2880
     accccggcag actccttcaa catcgacgaa gccatcgaag cggcgcttga agagccggaa      2940
     cgtgcgccag ccccgtacgg gctcgaagaa ctcggccatc tgctcgacca cccgaagctt      3000
     ctgccacccg gcgtcgaagc ccaacgggtc ggcacgaagg aggtcttctg gacgcagccc      3060
     ggagcgccgc gtatcagcgt caccaccgac ccggactttt tcgaggaaca tccggaatcg      3120
     gtcgagttct ggacgccggg cagcccggcg tttccggaag acagtggatc gggggttcaa      3180
     tcggctgatg gggagacact ggctaccctg attcgcgcga cacgggatct ttcaagtcgc      3240
     ttgagcaacc gtacgacaga gtgtgcgctg caatcggtca atgcggtact ctga            3294
//

If you have problems or comments...

PBIL Back to PBIL home page