(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE24

ACCPU_3.PE24         Location/Qualifiers
FT   CDS_pept        complement(22270..25227)
FT                   /locus_tag="CAP2UW1_4592"
FT                   /gene_family="HOG000055007" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091529"
FT                   /db_xref="GeneID:8401964"
FT                   /translation="MTRRLIETWLPIAALGIESLRERTPMTPFPAPNRLHVWWARRPLV
FT                   ASRAAVLASLLPVDADHGKFLHMLGIHGDAAASRRRIDAARRKGERFEGQAYSYSRAFT
FT                   YAPSDADRSWARTGYGRLGLDQIAVLDPTAGGGAIPFESARLGFDTFGNDLNPVAALIE
FT                   RATIELPLKHGLAVLRQFERIASEYIERREKRLLPFFPPEPAENAIPTNFIWARTIRCP
FT                   HCEGLVPLSPNWRLAPDGTGVRLLPDKGKGPGDKTRHLHFEIVSTAKEHSTSTVSGGDA
FT                   TCPFDDCGRLIAGDHIKAEAQAGRMGQQLYTVVFKKKLITGHTKAGKPKEKWVRGYRAP
FT                   RPEDDVSEAVADALTEKLPDWEALDMVPTERVPEDINDDRPIQYGMPLWRDLFSPRQLL
FT                   GHCTAVEVFRELIVEEKSFGRWNECTAAAFCYLSFSLDKLRDYNSRMSRWHVNREVMVN
FT                   TFDRHDFAFKWSYAEMPPLIEGLGYDWAIEQTAKCIGELVALTRPDAGATASPQSKFNF
FT                   DGAPAFTPPPVTLTCKSGDSLDHIADASIDAVVMDPPYYDNVMYAELSDFFYVWLKRTA
FT                   GYIYPELFRRALTDKENEAVANPAKFKGEKGAKALAGRDYQQRMAAIFTEMRRVLKPDG
FT                   IMTLMFTHKATGAWDALTKGLMEAGFAITASWPINTEAEGSLHIKDKSAANSTVFLVCR
FT                   PLAQPGADTRYWEDVEPKVRAAVRERIGVFQTAGIRGVDLYLSCFGPALEVFSQAWPLV
FT                   RGTPRQDIEQSRRKRRQAEMFDEAYDPFAVTPEDALVAARTEVKQWRLSQLAHVRRNVE
FT                   LDNLTSWFVLAWDAFEAPIFPFDEANKLAKVCGVDLDRDVVGRLAEKKGADLVLWDSVT
FT                   RAAKGSLGLPDGRDSMMDALHQLARTARTASLESANELLAKHGLAVEPAFLTALEAVLE
FT                   VLPVGSIWSGFDLPDAAKGAGADFDALENLRRLALAEKVAEPEQLKIWQQEELTV"
FT                   /protein_id="YP_003165172.1"
     atgacccgcc gtctgattga aacctggtta ccaattgccg cgcttggcat cgaaagtctg        60
     cgcgagcgga cgccgatgac gccatttccc gcacccaacc gtctgcacgt gtggtgggca       120
     cgtcgaccct tggtggcttc tcgggcggcc gtcctcgcat cactgctgcc ggtggatgcg       180
     gaccatggca agttcctgca tatgttggga atacatggcg acgcggcagc ttcacgccgt       240
     cgtattgatg ctgcccgccg caaaggtgag cgattcgaag gccaggccta cagctactcc       300
     cgtgcattta cctatgctcc gagcgacgca gacaggagtt gggctcgaac gggatacggt       360
     cgattgggac tcgaccagat tgcagtcctt gatccaaccg cgggaggcgg ggcgatccct       420
     tttgagtcag cgcgtcttgg gtttgacact ttcggtaacg acctcaatcc ggtcgcagcc       480
     ctgattgaac gcgccacaat tgagttgccg ctcaagcacg ggcttgcagt gctgcgccag       540
     ttcgagcgta ttgcatctga gtacatcgag aggcgggaga agcgcttgtt gccgtttttc       600
     ccgcccgaac ctgcggaaaa cgcgatcccg accaatttca tctgggcgcg aacgatccgc       660
     tgtcctcatt gcgagggtct tgtcccgctc tcgcccaact ggcgactcgc cccggatggt       720
     acgggggtcc gcctgctgcc ggacaagggc aagggacctg gagacaagac cagacatctg       780
     cacttcgaaa tcgtcagcac cgccaaggag cattcgacaa gcacagtctc cggtggtgac       840
     gccacctgcc cttttgacga ctgcgggcga ttgatcgctg gcgaccatat caaagccgaa       900
     gctcaggcgg ggcgaatggg tcaacagctt tacaccgtgg tcttcaagaa aaagctgatc       960
     accggccaca cgaaagctgg caagcccaag gaaaagtggg tacggggtta ccgtgcgcct      1020
     cgtccggaag acgatgtctc ggaggcagta gccgatgcct tgacagagaa gctccccgac      1080
     tgggaggctc tggacatggt tcctaccgaa agagtgccgg aagacattaa cgatgaccgt      1140
     ccgatacagt acggtatgcc actgtggcgt gacctgttct cgccgcggca actccttggc      1200
     cactgcactg ccgtcgaagt gttccgggaa ctgattgttg aggaaaagtc atttggtcgg      1260
     tggaacgaat gcacggcggc ggcgttctgc tatctctctt tctcactcga caagcttcgc      1320
     gactacaact cgcgcatgtc ccgttggcac gtcaatcgcg aggtgatggt caacactttc      1380
     gatcgtcacg actttgcttt caaatggtcc tatgcggaga tgccccccct aattgaaggc      1440
     ctcggctatg actgggcgat cgagcaaacg gcaaaatgca tcggtgagct ggtcgcgctc      1500
     actcgtcccg atgccggcgc cacggcgagt cctcaaagca agttcaactt tgacggcgca      1560
     ccggctttca cccctcctcc cgtcaccctc acctgcaaat ccggcgacag tctcgaccat      1620
     atcgccgatg ccagcatcga cgcggtggtg atggacccgc cgtactacga caacgtgatg      1680
     tatgccgagc tgtcggattt cttctacgtc tggctcaaac gcaccgccgg ttacatctac      1740
     ccggaattgt tccgccgcgc gctgaccgac aaggaaaacg aagcggtcgc caacccggcc      1800
     aagttcaagg gcgaaaaggg cgccaaggct ttggccggac gcgactacca gcagcgcatg      1860
     gcggccatct tcaccgagat gcgccgggta ctgaagccgg acggcatcat gacgctgatg      1920
     ttcacccaca aggcgacggg cgcctgggat gccctgacca agggactgat ggaagcgggt      1980
     ttcgcgatca ctgcctcgtg gccgatcaat accgaggccg aaggcagcct gcacatcaag      2040
     gacaaatcgg ctgccaattc gaccgtgttc ctggtctgcc gcccactggc gcagccgggt      2100
     gccgacaccc gctactggga agacgtggag cccaaggtcc gtgccgccgt acgcgaacgc      2160
     atcggcgttt ttcagaccgc cgggattcgc ggcgtcgatc tttatctctc ctgcttcggt      2220
     ccggcgctcg aagtgttctc gcaggcctgg ccgctggttc gcggcacccc tcggcaggac      2280
     atcgagcagt cgcgccgcaa gcgccggcag gcggagatgt tcgacgaggc ctacgacccc      2340
     ttcgccgtca cgccggaaga cgcactcgtc gctgcacgca ccgaggtgaa gcaatggcgg      2400
     ctctcgcagc ttgcgcacgt tcgccgcaat gtcgaactgg acaacctgac gagctggttc      2460
     gtgctcgcct gggacgcttt cgaagcaccg atcttcccgt tcgatgaggc caacaaactc      2520
     gccaaggtgt gcggcgtgga cctcgaccgt gacgtggtcg gccgactggc cgagaaaaag      2580
     ggggccgacc tcgtgctctg ggacagcgtc acccgtgccg ccaagggttc gctcggcctg      2640
     cccgatggtc gcgactcgat gatggacgcc ctgcaccagt tggccaggac cgcccgcacg      2700
     gcatcgctcg aatctgccaa cgaactgctc gcgaaacacg gactcgccgt ggaaccggcc      2760
     ttcctcaccg cgctcgaagc ggtgctagaa gtcctcccgg tggggtcgat ctggagcggc      2820
     ttcgatcttc ccgacgctgc caagggggcc ggggccgact tcgatgccct ggaaaacctg      2880
     cgccgcctgg cgcttgccga gaaggtggcc gaacccgagc agttgaagat ctggcagcag      2940
     gaagaattga cggtctga                                                    2958
//

If you have problems or comments...

PBIL Back to PBIL home page