(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE25

ACCPU_3.PE25         Location/Qualifiers
FT   CDS_pept        complement(25315..27051)
FT                   /locus_tag="CAP2UW1_4593"
FT                   /gene_family="HOG000158239" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091530"
FT                   /db_xref="GeneID:8401965"
FT                   /translation="MRELTEIRSLLDRLDEVEADALETQDLDFKEWPAEPRQAIKLAVD
FT                   IAICMANGGGGSVVLGVRDRVVGRAKAILGVPPETEIHQLKRDIYERTAPKLTPDIHEL
FT                   HVLEGSGRLLVMQVHGGLSPYTNTAGAGTVRKGNACVPLTGDLREKLMVERGDADFTAA
FT                   IVPEPAQSLISAAAMERLRDQARQEQAPTDLLRKSDLDLLGAIGVLRDGQLTRAGLLIA
FT                   GQAEAIGRHLPNFGWTHERMKSATAYDNRADGRDENALALPLALAAIEARINADNPIST
FT                   IEHGLYHFEYRAYPTIALREALLNALTHLDLRLASPVLVKQYPRRLEITNPGGLVGGIT
FT                   SANILHHPPLARNLQLVQALARLRLVNRSNLGIGRMFEAMLVEGKEPPLIIDEESAVRV
FT                   VFKRQETARPFREFIAEEGKTGRTLDVDHLLVLRYLLSHPEIDTSTAAELCQRRDAEMR
FT                   DILDEMVQIFDYLERGGAGRGSWWRMKPALHRRLEGLGHAERDQRIDWDVAKTRVLNML
FT                   KQRARRGEPGLTNAGIREVTAYDRQQVNRLIHELEAEGVRMQGHGRGSCYTYIGRTHNE
FT                   QG"
FT                   /protein_id="YP_003165173.1"
     atgcgcgaac tgaccgagat ccgcagcctg ctcgatcgcc tggacgaagt cgaagccgat        60
     gccctggaaa cccaggacct tgacttcaag gagtggccgg ccgaacccag gcaggcgatc       120
     aagctggctg tcgatatcgc gatctgcatg gccaacggcg gtggcggaag cgtcgtgctc       180
     ggggtgcgcg accgtgtcgt cgggcgggcc aaagcgatcc tcggcgtgcc gccagagaca       240
     gagattcacc aactgaaacg cgacatctac gagcgcaccg cgccgaagct gacgcccgat       300
     attcacgaac tgcacgtgct ggaaggcagc gggcgtttgc tggtcatgca ggtgcacggc       360
     ggcctgtcgc cctacaccaa cacggctggc gcggggacgg tacgcaaagg caacgcctgc       420
     gtaccgctga ccggcgacct gcgcgaaaag ctgatggtcg aacggggcga cgccgacttc       480
     accgcggcga tcgtccccga gccggcccag tcgctgattt cggccgccgc gatggagcgc       540
     ctgcgtgacc aggcgcgaca ggagcaggcg ccgaccgacc tgctgcgcaa aagtgacctc       600
     gacctgctgg gtgccattgg cgtgctgcgc gatggccagc tcacgcgggc gggcttgctg       660
     attgccggtc aggccgaagc cattggccgt cacctgccga actttggctg gacgcacgag       720
     cgcatgaaga gcgccaccgc ctacgacaac cgcgccgacg gtcgcgacga aaatgccctg       780
     gcgctgccgc tcgcgctggc ggcgatcgaa gcgcgcatca acgccgacaa cccgatcagc       840
     accatcgaac acgggcttta tcacttcgaa taccgcgcct atccgaccat cgcgctgcgc       900
     gaagcgctgc tcaacgcatt gacccacctt gacctgcgtc tggcgagccc ggtgctggtc       960
     aagcaatacc cccgccggct cgaaatcacc aaccctggcg gactggtcgg cggcatcacc      1020
     tcagccaaca tcctgcacca cccgccgctg gcccggaacc tgcagctcgt gcaggcgctc      1080
     gcccggctgc gcctggtcaa tcgcagcaac ctcggcatcg ggcggatgtt cgaggcgatg      1140
     ctggtcgagg gcaaggaacc gccgctgatc atcgacgagg aaagtgcggt tcgcgtggtt      1200
     ttcaaacggc aggaaaccgc ccgcccattt cgcgaattca ttgccgagga aggcaagacc      1260
     ggccgcaccc tcgacgtcga ccacttgctg gtgctgcgct acctgctctc gcatcccgag      1320
     atcgacacgt caaccgctgc cgagctgtgc cagcgccgtg atgcggaaat gcgcgacatc      1380
     ctcgacgaga tggtgcagat cttcgactac ctcgaacgag gcggtgccgg ccgcggtagc      1440
     tggtggcgca tgaagcccgc cctgcatcgc cggctcgaag ggctcggtca cgccgagcga      1500
     gaccagcgca tcgactggga tgtcgccaag acgcgggtgc tcaacatgct caagcagcgc      1560
     gctcgccgcg gcgaacccgg actgacgaac gccggtatcc gcgaagtcac cgcctacgac      1620
     cggcagcagg tcaaccgtct gattcacgaa ctcgaagccg aaggcgtcag gatgcagggc      1680
     catggccgtg gctcgtgcta cacctacatt ggtcggacac ataatgaaca gggatga         1737
//

If you have problems or comments...

PBIL Back to PBIL home page