(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE26

ACCPU_3.PE26         Location/Qualifiers
FT   CDS_pept        complement(27055..27534)
FT                   /locus_tag="CAP2UW1_4594"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091531"
FT                   /db_xref="GeneID:8401966"
FT                   /translation="MSKVTHLSAAKHASALPQYEMRARRLAGSDIEVEIWQLPAGATPH
FT                   IRQPTYIAGLRGRNLSLIEHRLLRRLKQLRIDLSNLPAFDALRLAVDEEMAISLGLLFR
FT                   ALAPMRNREHIAAVAEGIEAMSKEEAGYWLGMAMHRKHPRRVLMALRFLLIEPKP"
FT                   /protein_id="YP_003165174.1"
     atgagcaaag tgacccacct gagtgccgca aagcacgctt ctgccttgcc ccagtacgag        60
     atgcgcgcgc gccggctcgc tggctcggat atcgaggtcg aaatctggca actccctgcc       120
     ggcgcgacgc cgcacattcg gcagccgacc tacattgccg ggctgcgcgg tcgcaacctg       180
     tcgctgatcg agcaccgtct gttgcggcgc ctgaaacagt tgcgcatcga cctgagcaac       240
     ctgcccgcct tcgatgcgct caggctagcg gtcgatgaag aaatggcgat cagtctcggg       300
     ctgctgtttc gcgccctggc gccgatgcgc aaccgcgagc atatcgctgc ggtcgccgaa       360
     ggcatcgaag cgatgagcaa ggaagaagct ggctactggc tcggcatggc catgcaccgc       420
     aagcacccgc ggcgtgtact gatggcgctg cgcttcctgc tcatcgagcc gaagccctga       480
//

If you have problems or comments...

PBIL Back to PBIL home page