(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE27

ACCPU_3.PE27         Location/Qualifiers
FT   CDS_pept        complement(27557..30589)
FT                   /locus_tag="CAP2UW1_4595"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091532"
FT                   /db_xref="GeneID:8401967"
FT                   /translation="MTDNLFSICEPRPDVLQGALRESDFAADLSQVLRGDAPDEYKRPE
FT                   LFFANTYPTKGIKNVLKLVALRVSGHSDQIGAIFRLDTQFGGGKTHALIALAHAMRSLS
FT                   EVANADEFLDASLRPSAPVRIAAFDGENADPANGHRIGDTLRAYTPWGELAYALRGEAG
FT                   YRLVEASDREGIAPGADTLRELIGSEPAVILIDEIAPYLRKVAGRNAQRAGEQLLAFMT
FT                   SLMKAVESSPYAALVFTLAVGRDGKASDAYSRETQDIAAFFAEAESVAARKATVIDPTE
FT                   DDETVKVICRRLFTRIDRDKARLVISAYKSLWDANRELLPPAPAEDRRLDEFAAGYPLH
FT                   PELVNVLTQKTGTLGNFQRVRGMLRLLARTVARVWQTHPADAYAIHTHHIDLGFEPIRL
FT                   ELVTRLKQDIYVPAIKTEIAAVETTPALAEQLDAGPFRGLPKYGSYVARCAFMHTLAFN
FT                   ETLRGLNAEELRYAILSPGTDVAFIDDARKRFATDSAYLDDKPGAPLRFLAEANLTQII
FT                   RREETNTDRDEARTRLNSFIRDLFAGPNLNLIPFASGPHDVPDDDGSGRPYLVMLGYEA
FT                   TQVFSDAVTVDNLVEKVFLHKGGGSDWRHNRNNIVFLLADAAGVPNMKAKMLRNIALES
FT                   LRQPGKLKDLADYQVAKLQELHERSKQELALAVQQCFRHIFYPSRNRLDGANCDLAHTV
FT                   VDIQTASDRPGDGQRQVVTQLQNAGKLRLPTDKPDSPVYVRDRTPLKKGQITTAALRTE
FT                   FRQDPSLPMLVGDEVFIKGIRLGIEQDDYVYQSGDLLRGKGDPHAEIKVDEQSFIYTTS
FT                   YAQEHGIWPRQEPKSETSKTDSGARPTNDQADQRPVDYAATSDRTMPKAKSPPLLEAED
FT                   VLKAALTRLLEQARLNGIRSLATLTIRPFDKSDALKLMPLVKSIPNASKRVEMTASFET
FT                   ASGSSAELSFKGDIEDAIALKDYLEPQFRAASDSDAAVSFSLRFEPPLAVQGPSAEGLI
FT                   QRLTRLVSPSAHVLATAAEQD"
FT                   /protein_id="YP_003165175.1"
     atgaccgaca atctgttctc catctgtgag ccgcgacctg atgttctgca aggtgcgttg        60
     cgtgaaagcg actttgctgc ggacctctcg caggtgttgc ggggagacgc tcccgacgaa       120
     tacaagcgcc cggagctgtt ctttgccaac acctacccga ccaaaggcat caagaacgtc       180
     ctcaagctgg ttgcgctgcg ggtcagtggc cattccgacc agattggcgc catctttcgt       240
     cttgacaccc agtttggcgg cggcaagacg catgccctga ttgcgctcgc ccacgccatg       300
     cgcagcctct ccgaggtggc gaacgccgac gagtttctcg atgcctccct gcgcccctcg       360
     gcaccggtgc gcattgccgc ctttgatggc gaaaatgccg atccggccaa cgggcaccga       420
     attggcgaca ccctgcgcgc ctacacaccc tggggcgaac tggcgtatgc gctgcgtggt       480
     gaggccggtt atcgcctcgt cgaagcgagc gaccgcgaag gaatcgcgcc gggtgccgac       540
     accttgcgcg aactgatcgg cagcgagccg gcggtgatcc tcatcgacga aatcgcccct       600
     tacttgcgca aggtggccgg tcggaatgct cagcgagcag gcgaacagct cctggcgttc       660
     atgacttcgc tgatgaaggc ggtggaaagc tcgccctatg cagcgctggt tttcacgctc       720
     gcggtcggcc gtgacggcaa agcctcggac gcctacagcc gcgaaaccca ggacatcgct       780
     gccttcttcg ccgaggccga aagcgtcgcc gcccgcaagg cgacggtgat cgaccccacc       840
     gaggacgacg agaccgtcaa ggtcatctgc cgacggctgt tcacccgcat cgaccgcgac       900
     aaggcacggt tggtcatctc cgcgtacaag tcactgtggg acgccaaccg ggagctgctt       960
     ccgccggccc cggccgagga ccggcgcctg gacgagtttg ctgccggcta tccgctgcac      1020
     cctgaactgg tgaatgtgct gacgcagaaa accggcaccc tgggcaactt ccagcgcgtg      1080
     cgcggcatgc tgcgtctgct cgcgcgtacg gttgcacgcg tctggcagac gcaccccgcc      1140
     gacgcctacg cgattcacac gcatcacatc gacctcgggt tcgagccgat acgcctcgaa      1200
     ctcgtcaccc gcctcaagca ggacatctac gtgccggcca tcaagaccga gattgccgcc      1260
     gtcgaaacca cgccggcctt ggctgaacaa ctcgacgcag ggccgttcag gggccttccg      1320
     aagtatggat cgtacgtcgc ccgctgcgcc ttcatgcaca ccctggcgtt caacgagacc      1380
     ttgcgcggac tcaacgccga ggaactgcgc tacgccatcc tgagcccggg aacggatgtc      1440
     gcattcattg acgacgcacg caaacgcttc gcgaccgact cggcgtatct cgacgacaaa      1500
     cccggtgcgc cgctacgttt tctggccgag gccaatctca cccagatcat tcggcgcgaa      1560
     gaaaccaaca ccgaccgcga cgaggcgcgc acccgcctga acagcttcat ccgcgatctc      1620
     ttcgccggtc ccaatctcaa tctcatcccc ttcgcttccg gccctcacga cgttcccgat      1680
     gacgatggca gcggacgccc ctacctggtg atgctcggct acgaagccac ccaggtcttc      1740
     agcgacgcgg tcaccgtcga caacctggtc gagaaagtct ttctgcacaa ggggggtgga      1800
     agcgactggc gccacaaccg gaacaatatc gtcttcctgc tggcagacgc tgccggggtg      1860
     cccaacatga aggccaagat gctgcgcaac atcgcgctgg agtcgctgcg gcaacccggc      1920
     aagctcaagg acctggcgga ctatcaggtg gccaagctgc aggaactgca cgaacgctcc      1980
     aagcaggaac tcgcactcgc cgtgcagcag tgtttccgac acatcttcta cccatcccgc      2040
     aatcgactcg acggggccaa ctgcgacctc gcgcacaccg tggttgacat tcaaaccgcc      2100
     tcggatcggc cgggtgatgg ccaacgccag gtcgtcaccc agctccagaa cgccggcaaa      2160
     ctgcgcctgc cgaccgacaa accagactcg ccggtctacg tgcgtgaccg cactcccctc      2220
     aagaaaggcc agatcaccac cgccgctctg cgcaccgaat tccgccagga cccgtccctg      2280
     ccgatgctcg tcggtgacga ggtgttcatc aaaggcattc gtctgggtat tgagcaggat      2340
     gactacgtct accagtcagg cgacctcctg cgtggcaagg gggacccgca tgccgaaatc      2400
     aaggtcgacg agcagtcgtt catttatacg acttcgtatg cccaggagca cggcatctgg      2460
     ccgcgacagg agccaaagag cgaaaccagc aagaccgact caggcgctcg cccgacgaat      2520
     gaccaggcgg atcagcgccc ggtagattac gctgcgacca gcgaccgaac gatgcccaag      2580
     gcgaagtccc ccccgctact tgaggcagag gacgttctca aggcagcgct cacccgtctt      2640
     ctggaacaag cgcggctcaa tggcatccgc agcctggcga cgctgaccat tcgaccattc      2700
     gacaaatcgg acgcgttgaa actgatgccg ctggtcaagt cgattccgaa cgccagcaag      2760
     cgggtcgaga tgaccgcttc tttcgaaacc gccagcggtt ccagcgctga actcagcttc      2820
     aagggcgaca tcgaagatgc gattgctctc aaggactacc tcgaaccgca gttccgcgca      2880
     gccagcgaca gcgacgccgc tgtttccttt tcgctccgct tcgagccgcc gctggccgtt      2940
     caggggcctt cggccgaagg cctgattcag cggctgacac gactggtttc gccctcggca      3000
     cacgtgctgg ccacggccgc agagcaggat tga                                   3033
//

If you have problems or comments...

PBIL Back to PBIL home page