(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE28

ACCPU_3.PE28         Location/Qualifiers
FT   CDS_pept        31062..32249
FT                   /locus_tag="CAP2UW1_4596"
FT                   /gene_family="HOG000005198" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091533"
FT                   /db_xref="GeneID:8401968"
FT                   /translation="MATLTWLDLTSRDRDKMRGVLDLFSEQGTVDEMGLGSLRDALSDA
FT                   LFPGTSSIQTRLRYALFVPWLYQRLEARPVDDVRTAAHEAETGLIEPLATSDDTFGVIG
FT                   ISARKTLSRLPSSVYWASLNRWGIFVPGQSQSWYHTHFAGLARRKSEVLRADDPGVVWT
FT                   REPTWHPRLPTAPADFPGCASFRLTKEEATFLQGRFEERCTGTLLAWLARAGSSTPAAQ
FT                   FWDDPGTCSAPSAVRRIVELARRFSLHVEGAPLLYNLLLAERRNGGGDDARVDAYRSEL
FT                   ARWAAEESAEAAYESPPLWAFLAERGASLSDPQRRFVEAWSDRISSSGASAVPDDPFLR
FT                   NLIEQRELKLKGRRARLANANRLLDWSGSVGVGRMGFRWFRVRQLLTDLHGGLKS"
FT                   /protein_id="YP_003165176.1"
     ATGGCAACGC TTACGTGGCT CGACCTCACC TCCCGCGACC GCGACAAGAT GCGCGGCGTG        60
     CTCGACCTGT TCAGTGAGCA GGGGACGGTC GACGAAATGG GGCTCGGGAG CCTACGCGAT       120
     GCGCTGTCGG ACGCGCTGTT TCCGGGCACC TCATCAATCC AGACGCGGCT TCGATACGCG       180
     CTGTTCGTCC CGTGGCTCTA CCAGCGGCTG GAAGCCAGAC CCGTAGACGA TGTCCGCACG       240
     GCGGCACATG AGGCCGAGAC CGGATTGATC GAGCCTCTCG CGACCAGCGA CGACACCTTC       300
     GGCGTGATCG GGATCTCCGC ACGCAAGACG CTTTCCCGCC TGCCCAGCTC GGTCTATTGG       360
     GCAAGTTTGA ATCGCTGGGG TATCTTCGTG CCTGGACAGA GCCAGTCCTG GTACCACACC       420
     CACTTTGCCG GGCTCGCCCG TCGCAAGAGC GAGGTGCTTC GCGCTGACGA TCCCGGTGTG       480
     GTGTGGACGC GGGAGCCGAC GTGGCATCCG CGGCTACCCA CGGCGCCCGC TGACTTTCCG       540
     GGATGTGCCT CATTTCGACT GACGAAGGAA GAAGCGACAT TTCTACAGGG ACGATTCGAG       600
     GAGCGATGTA CGGGCACGTT GTTGGCCTGG CTCGCACGCG CAGGGTCGTC CACGCCCGCA       660
     GCACAGTTCT GGGACGACCC CGGCACCTGT TCGGCGCCTT CGGCGGTACG CCGCATCGTC       720
     GAGTTGGCGC GACGCTTCTC GCTACACGTG GAAGGGGCGC CGCTCCTGTA CAACCTGCTA       780
     CTGGCCGAGC GGCGCAACGG CGGTGGCGAC GATGCCCGGG TCGACGCGTA TCGGTCCGAG       840
     TTGGCCCGAT GGGCAGCCGA GGAATCCGCC GAGGCAGCGT ACGAATCGCC CCCGCTCTGG       900
     GCCTTCCTCG CTGAACGAGG GGCCAGTCTT TCCGACCCCC AGCGCCGTTT CGTCGAGGCT       960
     TGGTCGGACC GGATCAGCTC CAGTGGTGCA TCTGCTGTCC CCGACGACCC GTTCCTTCGC      1020
     AACCTCATCG AGCAGCGCGA GCTCAAGCTC AAAGGACGAC GCGCCCGCTT GGCCAACGCC      1080
     AACCGGTTGC TCGACTGGAG CGGCAGCGTG GGCGTCGGTC GAATGGGCTT TCGCTGGTTT      1140
     CGTGTCCGCC AACTTCTCAC GGACCTTCAT GGCGGCCTGA AGTCCTGA                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page