(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE3

ACCPU_3.PE3          Location/Qualifiers
FT   CDS_pept        1485..2105
FT                   /locus_tag="CAP2UW1_4570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091508"
FT                   /db_xref="GeneID:8401943"
FT                   /translation="MPTPTSLNCHAPWKTCSNTHRDGTTHWQPRLRARSTSIVTRRTAS
FT                   RRCWRRWGVCNALYTPRAGQAVESSVLPVSPLARPSASHPLPRSLHWKQQEQGLDVWVR
FT                   FRPITAGQVFCPNDSNAAVAVVQPGVRRAQVTYELGAVGVGRPRRKFMSGCVASAARPP
FT                   SCVSSCGAKGARPSPLQTPPAAQQHRSTPAHQQGEHRNAAASN"
FT                   /protein_id="YP_003165151.1"
     GTGCCGACGC CGACGAGCTT GAATTGTCAT GCTCCGTGGA AGACTTGCTC CAACACGCAT        60
     CGGGACGGGA CGACGCACTG GCAACCGAGG TTGAGAGCGA GATCAACCAG TATCGTCACC       120
     AGGCGCACTG CATCGCGGAG ATGCTGGCGA CGCTGGGGCG TCTGCAACGC CTTGTACACT       180
     CCCCGCGCCG GACAAGCGGT GGAGAGCAGC GTGCTTCCCG TCTCACCGCT TGCGAGGCCA       240
     TCGGCGTCGC ACCCGCTGCC GCGATCGCTT CACTGGAAGC AGCAGGAGCA AGGTCTTGAC       300
     GTTTGGGTCC GCTTCCGACC CATAACAGCC GGTCAAGTTT TTTGCCCCAA TGACAGCAAC       360
     GCAGCGGTTG CGGTCGTTCA GCCAGGAGTG CGGCGCGCAC AAGTGACGTA TGAATTAGGT       420
     GCGGTGGGCG TAGGTCGTCC GCGCCGCAAG TTCATGAGCG GATGCGTTGC ATCGGCGGCC       480
     AGACCGCCAA GCTGCGTGAG CAGTTGCGGC GCGAAGGGCG CGCGGCCCTC CCCTTTGCAA       540
     ACCCCACCGG CAGCACAGCA GCACCGCAGC ACACCAGCAC ATCAGCAGGG TGAGCACCGC       600
     AATGCTGCCG CAAGCAATTG A                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page