(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE30

ACCPU_3.PE30         Location/Qualifiers
FT   CDS_pept        34036..37182
FT                   /locus_tag="CAP2UW1_4598"
FT                   /gene_family="HOG000005196" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091535"
FT                   /db_xref="GeneID:8401970"
FT                   /translation="MNRSDIEVVLASLKPFQRRTVDHAFDRLFLAKDSTSRFLVADEVG
FT                   LGKTLVARGLIARTIEHLWDTAKRIDIVYICSNGSIARANLPKLHVGATSDRSFALATR
FT                   LTMLATELAPRAGKPGLAASKVNFVSFTPGTSFDMGKATGQSEERVVLFRLLEPVVKAR
FT                   TGLMNLLQAGISNRDNWRWRLKNSDIALDPSIATNFRTALNADTALLTSINDVIEQWYH
FT                   YHRDRWPLEARQPRNYVISQLRQMLAKVCVLALEPDLVILDEFQRFKNLLETREDVRDE
FT                   AAILAQTLFGAQTPEGQPVRTLLLSATPYKLYTADAEIQDEDHYEDFLATSRFLMGNDE
FT                   ERVTSLQRCLSEFGLALKHAASGNTVAVVPAKKAVEKVLRSIMARTERISASEDRDAMV
FT                   EEPCVKITVKGADVKQYMAADALFKAVGDRDPMVFWKSAPYLMHFMRGYTVHTRIQETL
FT                   EQSPERLAKVLREHAAAFLEADKVTAWQAIDPANGKLREMVEDFLDGGLWRLLWMPPTF
FT                   PYWPLAGPFAGQEGKTKALVFSSWNVVPDVVSAILSYEAERRMVGSHLASYSDPAKQQV
FT                   PLLRLTASANGARSRHRLLLLLLPCLSLADQAHPLTAPAGINRRDWVRSRVESLLAIQP
FT                   NATTGDVDERWEWAAPMLLDPGLRSFIEELRAENSPDRPNPEQFPSYLDDLLQLDLTTL
FT                   GRRPEGLVDLLSDLALASPAVVVARTLAGAGVDDDVRRRLSLRLGESFWRMFNRPTVIS
FT                   LLLQLAQEAPDLTHNEGVYWRLVLRYCRDGNLQAVVDEAWHLEREQHTWAVDQTAETTA
FT                   EKVIAQLIKVVEPTPSRVHTSFWSVDADTGNILSTEIRVRTDFALRFGDVRTEEGKVTQ
FT                   DTVRAEFNSPFRPFVLASTSVGQEGLDFHPWCHRLVHWNLPGNPVDLEQREGRVHRYKG
FT                   HAVRKNVALSHATETLAVWKPGEDLWQIAFQFANDKARATGESDLVPNWIAPGPVRVQR
FT                   HVPMLPYTQEVEAFKRLKRQLAAYRVVFGQPRQDELLTLLDQAQLDVKQLREWAVDLSP
FT                   "
FT                   /protein_id="YP_003165178.1"
     ATGAACCGCT CCGACATTGA GGTTGTCCTC GCATCGCTCA AGCCTTTTCA GCGCCGAACA        60
     GTCGACCATG CATTCGATCG ACTGTTCCTG GCCAAGGACA GCACGAGTCG GTTTCTGGTC       120
     GCCGACGAGG TTGGACTGGG TAAAACACTT GTTGCCCGGG GACTCATTGC TCGGACGATC       180
     GAGCATCTAT GGGACACGGC TAAGCGCATT GACATCGTGT ATATCTGCAG CAACGGGAGC       240
     ATCGCGCGGG CGAACCTCCC GAAGCTTCAC GTCGGCGCAA CGAGTGACCG CTCCTTCGCC       300
     CTCGCAACGC GTCTTACGAT GCTCGCCACC GAGCTCGCGC CGCGAGCAGG CAAGCCTGGG       360
     CTGGCGGCGA GCAAGGTGAA CTTCGTCAGC TTCACCCCAG GGACCTCCTT CGACATGGGT       420
     AAGGCAACCG GGCAGTCGGA GGAGCGAGTC GTGCTGTTCC GGCTGCTCGA GCCGGTGGTC       480
     AAAGCGCGCA CCGGCCTGAT GAATCTGCTG CAAGCTGGAA TCTCAAACCG AGACAACTGG       540
     CGCTGGCGGT TAAAAAACTC GGATATCGCG CTCGACCCAT CGATCGCCAC CAACTTTCGA       600
     ACGGCTCTGA ATGCCGACAC TGCGCTGCTG ACATCGATCA ACGACGTCAT CGAACAGTGG       660
     TATCACTACC ATCGGGACCG CTGGCCACTC GAGGCCCGAC AGCCCCGAAA CTACGTCATC       720
     AGCCAGCTCC GGCAGATGCT GGCGAAGGTC TGTGTGCTCG CGCTGGAGCC CGACCTCGTC       780
     ATCCTCGACG AATTCCAGCG CTTCAAGAAT CTTCTCGAAA CACGAGAGGA TGTACGTGAT       840
     GAAGCCGCCA TCCTCGCCCA AACGCTGTTC GGCGCTCAAA CGCCGGAAGG CCAACCCGTT       900
     CGAACGCTCT TGCTGTCGGC CACTCCCTAC AAGCTCTACA CGGCCGATGC CGAAATCCAG       960
     GACGAGGATC ACTATGAAGA CTTCCTGGCC ACAAGCCGAT TCCTCATGGG GAATGACGAG      1020
     GAGCGGGTCA CCAGCCTGCA GCGATGCTTG TCAGAGTTCG GGCTTGCGCT GAAGCATGCA      1080
     GCCTCGGGAA ACACCGTAGC CGTCGTGCCG GCGAAGAAGG CGGTCGAGAA GGTGCTTCGC      1140
     TCGATCATGG CGCGCACTGA GCGTATTTCG GCCAGCGAGG ACCGCGACGC GATGGTGGAG      1200
     GAGCCGTGCG TCAAGATCAC AGTGAAAGGC GCAGACGTCA AACAGTACAT GGCTGCTGAT      1260
     GCCTTGTTCA AAGCTGTCGG CGATAGGGAT CCGATGGTGT TCTGGAAGTC AGCCCCGTAT      1320
     CTGATGCACT TCATGCGAGG CTACACGGTG CATACCCGCA TCCAGGAGAC GCTCGAGCAA      1380
     TCACCTGAGA GGCTCGCAAA GGTCCTGCGG GAACACGCGG CGGCGTTCCT CGAAGCCGAC      1440
     AAGGTAACGG CATGGCAGGC GATCGACCCG GCGAACGGAA AGCTCCGCGA GATGGTGGAA      1500
     GACTTTCTCG ACGGCGGCCT GTGGCGACTG CTGTGGATGC CTCCTACCTT TCCGTATTGG      1560
     CCGCTCGCAG GCCCATTCGC CGGGCAGGAG GGCAAGACCA AGGCGCTAGT CTTCTCCTCG      1620
     TGGAACGTTG TTCCCGACGT GGTCAGTGCG ATCCTTAGCT ACGAGGCAGA ACGGCGAATG      1680
     GTCGGTTCGC ACCTTGCCTC CTACTCGGAT CCCGCCAAGC AGCAGGTTCC GCTTCTCCGG      1740
     CTGACCGCAT CGGCGAACGG CGCTCGTTCC CGGCACCGTC TGCTGCTGCT CCTCCTTCCA      1800
     TGCCTTTCAT TGGCCGACCA GGCGCATCCG CTCACCGCGC CAGCGGGGAT CAACCGGCGG      1860
     GATTGGGTTC GCTCGCGGGT AGAAAGTCTG CTGGCAATCC AACCAAATGC GACGACCGGT      1920
     GACGTCGACG AGCGCTGGGA GTGGGCGGCG CCGATGCTAC TCGATCCCGG CCTCCGCTCG      1980
     TTCATAGAGG AATTACGCGC TGAGAACAGT CCCGATCGAC CGAACCCGGA GCAGTTTCCC      2040
     TCGTACCTCG ACGACTTGTT GCAACTCGAC CTCACGACAC TGGGCCGCCG GCCCGAGGGG      2100
     CTTGTCGATC TGCTCTCCGA TCTGGCCCTG GCATCCCCGG CTGTGGTGGT TGCGCGCACA      2160
     CTGGCTGGTG CCGGAGTGGA CGACGACGTT CGCCGGCGCC TCAGCCTTCG GCTCGGCGAG      2220
     TCGTTCTGGC GGATGTTCAA CCGGCCCACC GTGATCTCGC TCCTACTCCA GCTTGCGCAA      2280
     GAAGCGCCGG ACCTCACACA CAACGAGGGC GTGTATTGGC GTCTGGTGCT GCGGTATTGC      2340
     CGCGACGGGA ACCTCCAGGC AGTGGTTGAC GAAGCGTGGC ATCTGGAGCG TGAACAGCAC      2400
     ACATGGGCAG TCGACCAGAC AGCCGAAACT ACTGCAGAGA AGGTCATCGC GCAGCTCATC      2460
     AAGGTCGTTG AGCCAACCCC CTCGCGTGTT CACACTTCGT TCTGGTCCGT GGATGCGGAC      2520
     ACTGGCAACA TTCTCTCCAC CGAAATTCGA GTGAGAACAG ACTTCGCCCT GCGCTTCGGC      2580
     GATGTGAGGA CAGAGGAAGG CAAGGTCACG CAGGATACCG TCCGCGCGGA GTTCAACAGC      2640
     CCCTTCCGAC CATTCGTGCT AGCGAGCACC TCGGTCGGGC AGGAGGGGCT CGACTTCCAC      2700
     CCCTGGTGCC ATCGCTTGGT TCACTGGAAC CTCCCAGGAA ATCCAGTGGA TCTCGAACAG      2760
     CGGGAAGGGC GGGTGCACCG ATACAAGGGC CATGCTGTAC GAAAAAACGT GGCGCTTTCA      2820
     CACGCTACGG AGACGCTTGC CGTCTGGAAA CCTGGTGAGG ACCTGTGGCA AATTGCCTTC      2880
     CAATTCGCGA ACGACAAAGC GCGCGCAACA GGGGAAAGTG ACCTAGTACC GAACTGGATC      2940
     GCCCCAGGGC CGGTGAGGGT GCAACGGCAC GTACCCATGC TTCCGTACAC GCAAGAAGTC      3000
     GAAGCCTTCA AGCGTCTGAA GCGACAACTT GCAGCCTACC GTGTGGTGTT CGGGCAACCG      3060
     CGGCAGGACG AGCTGCTCAC GCTGCTGGAC CAAGCGCAGT TGGATGTCAA GCAGCTACGT      3120
     GAGTGGGCGG TGGATCTGTC GCCATGA                                          3147
//

If you have problems or comments...

PBIL Back to PBIL home page