(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE31

ACCPU_3.PE31         Location/Qualifiers
FT   CDS_pept        37898..38206
FT                   /locus_tag="CAP2UW1_4599"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091536"
FT                   /db_xref="GeneID:8401971"
FT                   /translation="MMSNDVLDKVGKRLGDLSDLPEALRKQINTGKMGDIEEKILKTMR
FT                   QRYDGIATIDEILVGLFRDFQYVTEDRRTLAGKLYRMTRAGHLEGVPKRKGVWKVKE"
FT                   /protein_id="YP_003165179.1"
     ATGATGAGCA ACGACGTTCT TGACAAGGTT GGAAAACGGC TTGGCGACCT GAGCGACCTG        60
     CCGGAAGCAC TGCGCAAGCA GATAAACACT GGCAAGATGG GCGACATTGA GGAAAAAATC       120
     CTCAAGACGA TGAGACAACG CTACGACGGA ATCGCGACGA TTGACGAAAT ATTGGTCGGT       180
     CTGTTCAGGG ACTTCCAGTA CGTGACGGAA GACAGACGGA CATTGGCAGG CAAGCTGTAC       240
     CGGATGACCA GAGCTGGGCA TCTTGAAGGC GTACCGAAAC GCAAAGGCGT TTGGAAAGTG       300
     AAGGAATAG                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page