(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE32

ACCPU_3.PE32         Location/Qualifiers
FT   CDS_pept        38385..38675
FT                   /locus_tag="CAP2UW1_4600"
FT                   /gene_family="HOG000218314" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091537"
FT                   /db_xref="GeneID:8401972"
FT                   /translation="MTSRHEVKCINKTDRYNAHERIRAIGGVNPNGTNWKLTQEEAIRG
FT                   IEAGKWSFYVAVRGHIVNVIVAVSRFGNKYLKTEADGEQPNNLLSLYECVS"
FT                   /protein_id="YP_003165180.1"
     ATGACATCCC GTCATGAAGT GAAGTGCATC AACAAGACTG ACCGTTACAA CGCCCATGAG        60
     CGCATCCGCG CAATAGGCGG CGTCAATCCC AACGGGACGA ACTGGAAGCT CACGCAGGAG       120
     GAAGCCATTC GAGGCATTGA GGCCGGGAAG TGGAGCTTCT ACGTGGCTGT TCGGGGACAT       180
     ATCGTCAATG TCATCGTAGC GGTCAGCCGG TTCGGAAACA AGTATCTGAA GACGGAAGCG       240
     GACGGTGAAC AGCCGAACAA TCTGCTTTCG CTGTACGAGT GCGTTTCCTG A                291
//

If you have problems or comments...

PBIL Back to PBIL home page