(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE33

ACCPU_3.PE33         Location/Qualifiers
FT   CDS_pept        complement(38918..39910)
FT                   /locus_tag="CAP2UW1_4601"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091538"
FT                   /db_xref="GeneID:8401973"
FT                   /translation="MARTSAVEYERVAEACSSLFLEGKSPSFESVYELIGRKGGAKVVQ
FT                   GMIADWRKEMANRFMAGRTNPDLPEELITESDKVLTVVWHLALEKSDAAYADERSRLGQ
FT                   ARVDMAAAVTQAQERAAEFEREALSLQGERQALQARLQGSQAEIEDLRQRLSDTTTLLR
FT                   ARDEQIGQMREDGARLANTLESERRNHEAELLAERDRHEQAVNAERQRAHESVEREREI
FT                   AAGERQYLMRQTDEIRQAAKANEAVLKEQLQEAKSFAESFQARAGRAESEAAFWRGKAE
FT                   AAAEESGRWQRASEEAAGKIDGLQGRIRILEHELAQRAPEESPTEKPAN"
FT                   /protein_id="YP_003165181.1"
     gtggcacgca ctagcgcagt cgagtacgag cgggtcgccg aggcctgctc cagtctcttt        60
     ctcgaaggca agagtccctc gttcgaatcg gtctacgagc tgattggccg caagggtggc       120
     gccaaggtcg tccaggggat gatcgccgac tggcgcaagg agatggccaa ccgtttcatg       180
     gccggccgta ccaaccccga tctcccggaa gagttgatca ctgagagcga caaggtcctc       240
     accgtcgtct ggcacctggc gctggaaaag tccgatgccg cgtacgccga tgaacgaagc       300
     agactcggcc aggctcgcgt cgacatggct gcagcggtga cgcaagccca ggaacgcgct       360
     gccgagttcg agcgcgaagc cctttccttg cagggagagc ggcaagccct tcaggcgaga       420
     ctccagggaa gccaggccga gatcgaagac ttgcggcaac gcctgtccga taccaccacc       480
     ctccttcggg cccgtgacga gcagatcggc cagatgcgcg aagatggcgc ccggcttgcc       540
     aacaccctgg agagtgagcg acgtaatcac gaggcggaac ttctcgccga acgtgaccga       600
     cacgagcaag cggtgaacgc cgaacggcag cgggcgcacg aatcggtcga gcgcgagcgg       660
     gaaattgccg ccggcgaacg tcagtacctg atgcgccaga ccgatgagat ccggcaagcc       720
     gcaaaggcga atgaagccgt gctcaaggaa caactgcagg aggccaaatc cttcgccgag       780
     agtttccagg cgcgagccgg ccgggcagaa agcgaagcgg cgttctggcg cggcaaggcc       840
     gaagcggcgg cggaagagtc cggccgctgg cagcgggcgt cagaggaagc ggccgggaaa       900
     atcgatggct tgcaggggcg catacggatc ctggagcacg aactcgccca acgagcacca       960
     gaggagtctc cgacggaaaa gccggcgaac tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page