(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE34

ACCPU_3.PE34         Location/Qualifiers
FT   CDS_pept        complement(39897..40070)
FT                   /locus_tag="CAP2UW1_4602"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091539"
FT                   /db_xref="GeneID:8401974"
FT                   /translation="MDTPQAQIIEQEIHDLSGLLCDLYRRVAENAPERAGEIAGALQAN
FT                   ARQFAEIPSGTH"
FT                   /protein_id="YP_003165182.1"
     atggatacgc cgcaagcaca gatcatcgag caggaaattc acgacctcag tggcttgctg        60
     tgcgatctgt accgtcgcgt tgccgagaat gccccggagc gtgctggcga gatcgccggg       120
     gcgctacagg ccaacgcccg gcagtttgcc gagatcccca gtggcacgca ctag             174
//

If you have problems or comments...

PBIL Back to PBIL home page