(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE35

ACCPU_3.PE35         Location/Qualifiers
FT   CDS_pept        complement(40197..40511)
FT                   /locus_tag="CAP2UW1_4603"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091540"
FT                   /db_xref="GeneID:8401975"
FT                   /translation="MRVRLLDQAKNDLVALGQYYRDVGGDVLARKMVARIKTPVLSLKD
FT                   NPDIAPSYELAPGIRRLVVAKGAFLVFYRVRVDVEVLHIRRAARDSATGDELGQIATKE
FT                   "
FT                   /protein_id="YP_003165183.1"
     atgcgggtta ggttgctcga ccaggccaag aacgacttgg tggcgcttgg gcaatactat        60
     cgggacgttg gcggtgatgt gctggcgcgc aagatggtgg cacggatcaa gacgccagtg       120
     ctgtcgctca aggacaatcc agacattgct ccatcgtatg aactcgcgcc aggcattcgc       180
     cgcttggttg tcgcgaaagg cgcgttcctg gtgttctacc gcgtgcgtgt cgatgtcgaa       240
     gtactgcaca ttcggcgcgc cgcgcgggat tcggcaacag gagatgagtt ggggcagatc       300
     gccaccaagg aataa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page