(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE36

ACCPU_3.PE36         Location/Qualifiers
FT   CDS_pept        complement(40501..40926)
FT                   /locus_tag="CAP2UW1_4604"
FT                   /gene_family="HOG000254028" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091541"
FT                   /db_xref="GeneID:8401976"
FT                   /translation="MQNMTLEQFRATVESGGILSVVLKAQGAAFAIQAETQRGDAVLVD
FT                   TRRKLPRLFGDPRKALALLSEMGIKKAAVDTEAWRPEQADSLHPPRPDKSVKLKAAHEA
FT                   AELKRVLDERIAMADAQGAIWHEAEDVFDELVAAHAG"
FT                   /protein_id="YP_003165184.1"
     atgcaaaata tgacactaga gcagttccgc gccacggttg aatccggcgg aatcctgtca        60
     gttgtcctca aggcacaggg cgcggccttc gccatccagg cagaaactca gcgcggcgat       120
     gcggtgctgg tcgatacgcg caggaaattg ccgcgcctgt tcggtgatcc gcgcaaggcg       180
     ctggccctgc tgagcgagat gggcatcaaa aaggcggctg tcgataccga agcttggcga       240
     ccagagcagg ccgattcctt gcatccgccc cggccagaca agtcggtgaa gctgaaagcc       300
     gcgcacgaag ctgctgagct caagcgcgtc ctcgacgaac ggatagcgat ggccgacgcg       360
     caaggggcca tctggcatga agctgaggac gtctttgacg aattggtagc ggctcatgcg       420
     ggttag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page