(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE37

ACCPU_3.PE37         Location/Qualifiers
FT   CDS_pept        41365..41925
FT                   /locus_tag="CAP2UW1_4605"
FT                   /gene_family="HOG000236961" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091542"
FT                   /db_xref="GeneID:8401977"
FT                   /translation="MQESAKPWVLALDQPFMEGIANWPDGRFEYRYFGGHHMLQLCLGK
FT                   LSERDIAAFVRGQVHVGFYLRQAVLFILFKIEHLMDWSDQAFTLHLVTPEDRELLPHVP
FT                   GTHQALSLVLVEAESGLVKGMRLVTYSKHASALLHRILQQQLESPFDADRHAALVAEVY
FT                   RQYPHSRLLAKAAILIEKGGGQQ"
FT                   /protein_id="YP_003165185.1"
     GTGCAGGAGT CTGCAAAGCC CTGGGTACTG GCACTCGATC AGCCCTTTAT GGAGGGCATT        60
     GCCAACTGGC CCGATGGGCG CTTCGAATAC CGCTACTTCG GGGGCCACCA CATGCTGCAA       120
     CTGTGCCTGG GCAAACTGAG CGAGCGGGAC ATCGCTGCTT TCGTCCGGGG TCAGGTGCAT       180
     GTCGGCTTCT ACCTCCGACA GGCGGTGTTG TTCATCCTGT TCAAGATCGA GCATCTGATG       240
     GACTGGTCCG ACCAGGCTTT CACCCTCCAT CTGGTGACAC CGGAAGACCG TGAACTCCTG       300
     CCGCACGTCC CGGGTACCCA CCAGGCTCTG TCGCTGGTCC TCGTCGAAGC CGAAAGCGGA       360
     CTGGTGAAGG GCATGCGCCT CGTGACCTAC TCGAAACACG CTAGCGCCTT GCTGCACCGG       420
     ATCCTGCAGC AACAACTGGA ATCACCGTTC GACGCCGATC GCCATGCCGC TCTGGTCGCT       480
     GAGGTTTACC GGCAATATCC ACACTCCCGG CTGCTGGCCA AAGCGGCGAT CCTGATTGAG       540
     AAGGGAGGGG GACAACAGTG A                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page