(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE38

ACCPU_3.PE38         Location/Qualifiers
FT   CDS_pept        41922..43115
FT                   /locus_tag="CAP2UW1_4606"
FT                   /gene_family="HOG000193597" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091543"
FT                   /db_xref="GeneID:8401978"
FT                   /translation="MTLPTPLPFPVEPARNQALSGPRLTAASTDHEAVATWLAKYTDNR
FT                   HTLDSYRREAERLMLWATWHGKDLPGLMVEDVLAYKAFLSDPQPVDLWCQQTEPRTLPD
FT                   GSPNPLCRQVRRVTRRLPDGSANPTWRPFVSGLSASAVKQTTTILFGLFEHLAAIGYVH
FT                   ANLLRAAAKRTRKGQRQGQERYFDAAAWAALTECIEAMPKETAREAAHYHRTRFLFSFL
FT                   YLTGLRRFEMARARTSDLRFKRGQWWLEVLGKGSVEGVVPLPADALEAIKSYRESTGRP
FT                   ALPPSGTDEPLLMDLTGAGRPLSDRAIYAIVKEVCRQAASSVAAAQPDLARQIDSGSTH
FT                   WLRHTSASHQIDRGVDPFIVQRNLRHASFSTTEGYIHKDRDQQHRETEKHTMIDAPS"
FT                   /protein_id="YP_003165186.1"
     GTGACCTTGC CGACCCCCCT GCCCTTCCCC GTCGAGCCTG CCCGGAACCA AGCACTTTCC        60
     GGGCCGCGGC TGACGGCAGC CAGTACCGAT CATGAAGCGG TCGCCACCTG GCTGGCAAAG       120
     TACACGGATA ACCGCCACAC GCTTGACAGC TATCGCCGGG AGGCCGAGCG GTTGATGCTC       180
     TGGGCCACTT GGCACGGCAA GGATCTGCCC GGGCTGATGG TCGAGGACGT GCTGGCCTAC       240
     AAGGCTTTCC TGAGCGACCC GCAGCCGGTG GATTTGTGGT GCCAGCAGAC CGAGCCGCGG       300
     ACGCTGCCTG ACGGTTCGCC GAACCCCTTG TGTCGGCAAG TGCGACGGGT GACGCGCCGG       360
     CTGCCCGATG GTTCGGCAAA TCCCACCTGG CGTCCTTTCG TCTCGGGATT GTCAGCGTCG       420
     GCCGTAAAGC AGACCACGAC GATTCTCTTT GGTCTCTTCG AGCACCTGGC AGCCATCGGC       480
     TATGTCCACG CCAATCTGTT GCGGGCGGCA GCAAAGCGTA CCCGGAAAGG CCAGCGGCAA       540
     GGACAGGAAC GTTACTTCGA CGCGGCAGCC TGGGCGGCGC TGACGGAGTG CATCGAGGCG       600
     ATGCCCAAGG AGACTGCGCG GGAGGCGGCA CACTACCACC GCACCCGGTT CCTTTTTTCC       660
     TTCCTCTATC TGACCGGCCT GCGGCGCTTC GAAATGGCCA GGGCACGCAC GTCTGATCTT       720
     CGTTTCAAAC GCGGCCAATG GTGGCTTGAG GTGCTCGGCA AGGGAAGCGT CGAGGGCGTA       780
     GTCCCGCTGC CCGCGGACGC TCTGGAAGCG ATCAAGTCGT ATCGGGAGAG TACCGGCCGC       840
     CCTGCCCTGC CCCCCAGCGG CACGGATGAA CCGCTGCTGA TGGACCTAAC CGGCGCTGGC       900
     CGTCCGCTCT CCGATCGGGC GATCTACGCG ATCGTCAAAG AGGTGTGTCG CCAGGCGGCC       960
     AGCAGCGTCG CGGCCGCTCA GCCAGACTTG GCCAGGCAAA TTGATTCTGG GTCGACGCAC      1020
     TGGCTGCGGC ATACCTCGGC GAGCCACCAG ATCGACCGGG GTGTGGATCC CTTCATCGTC      1080
     CAGCGCAACC TGCGCCACGC GAGCTTCTCA ACGACTGAAG GTTACATCCA CAAGGACCGC      1140
     GACCAACAGC ATCGGGAAAC CGAAAAACAC ACGATGATCG ATGCGCCATC GTGA            1194
//

If you have problems or comments...

PBIL Back to PBIL home page