(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE39

ACCPU_3.PE39         Location/Qualifiers
FT   CDS_pept        43324..43896
FT                   /locus_tag="CAP2UW1_4607"
FT                   /gene_family="HOG000158240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091544"
FT                   /db_xref="GeneID:8401979"
FT                   /translation="MIAYGGPLSVSQLAHECCLSRQGTYQTLNSLVSQRLVRVLGQARS
FT                   QLFTMDTNHPLSPGLKELFGHEQCRWDELLQVLRDTFQTNKDIHAAWYYGSVARGEDEP
FT                   HSDLDIAVIAPDGRVDETVESVRQALREVEDRLYISCSIVGLSPSDVMRLSSGDDWWQN
FT                   MARDAKVLKGVGPEPYAATLIRQRMKA"
FT                   /protein_id="YP_003165187.1"
     TTGATTGCCT ATGGCGGCCC GCTCAGCGTA TCGCAATTGG CGCATGAGTG CTGCTTGTCG        60
     CGCCAAGGAA CCTACCAGAC ACTCAATTCT CTGGTAAGCC AGCGACTCGT GCGCGTACTC       120
     GGGCAGGCAC GTTCCCAACT ATTCACGATG GATACCAATC ATCCCCTGTC ACCCGGATTG       180
     AAGGAGCTGT TCGGCCATGA GCAATGCCGA TGGGACGAAC TTCTTCAGGT GCTGCGCGAT       240
     ACGTTCCAGA CCAACAAAGA CATTCATGCC GCCTGGTACT ACGGCAGTGT GGCACGGGGC       300
     GAGGACGAGC CCCATAGCGA TCTGGATATC GCGGTTATCG CGCCGGATGG CCGGGTAGAC       360
     GAGACGGTGG AATCCGTGCG GCAAGCGTTG CGCGAAGTCG AGGACCGGCT GTACATCAGT       420
     TGTTCGATTG TAGGCTTGTC GCCATCCGAC GTCATGAGGC TGTCCAGCGG CGACGACTGG       480
     TGGCAGAACA TGGCTCGCGA TGCCAAGGTT CTCAAAGGCG TCGGTCCGGA GCCGTATGCC       540
     GCGACACTCA TCCGCCAGCG TATGAAGGCG TGA                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page