(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE4

ACCPU_3.PE4          Location/Qualifiers
FT   CDS_pept        2301..2894
FT                   /locus_tag="CAP2UW1_4571"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091509"
FT                   /db_xref="GeneID:8401944"
FT                   /translation="MANSKQSQTRRLKMSERAQQQLALHFPDVPETLLWRRKSNDGFTT
FT                   VPRPLPIAMQAIDETSKGAPAGHALFCLWARAPDNPLVIVENPATFAAETGFTGERATD
FT                   TWRKRMRRLRELGFIRTKPGPSGEFHFILLLNPNIAVEMMRRNGQIQDSLYGRFIERVA
FT                   DVGAAGDWAAHREALEAAEKAATAKSEALDKGAK"
FT                   /protein_id="YP_003165152.1"
     ATGGCCAACT CAAAGCAATC CCAGACCCGG CGCCTCAAGA TGTCCGAGCG CGCGCAGCAG        60
     CAGCTCGCGC TGCATTTCCC GGACGTGCCC GAGACGCTGT TGTGGCGGCG CAAGAGCAAC       120
     GACGGTTTCA CTACGGTGCC GCGCCCCCTG CCCATCGCGA TGCAGGCCAT CGATGAGACC       180
     TCCAAAGGCG CGCCGGCCGG CCACGCCCTG TTCTGCTTGT GGGCGCGCGC CCCTGACAAC       240
     CCGCTGGTGA TCGTGGAGAA CCCGGCGACC TTCGCCGCCG AGACCGGCTT CACCGGCGAA       300
     CGCGCGACCG ACACCTGGCG CAAGCGCATG CGTCGCCTGC GGGAACTCGG GTTCATCCGC       360
     ACCAAGCCCG GCCCGTCGGG CGAGTTCCAC TTCATCCTGC TGCTGAACCC TAACATCGCC       420
     GTGGAGATGA TGCGTCGCAA CGGCCAAATC CAAGACAGCC TATACGGGCG ATTCATCGAG       480
     CGCGTTGCCG ACGTGGGCGC GGCCGGGGAC TGGGCCGCGC ACCGGGAGGC TTTGGAAGCG       540
     GCCGAGAAAG CCGCCACCGC TAAGTCGGAA GCTTTGGACA AGGGGGCGAA GTGA             594
//

If you have problems or comments...

PBIL Back to PBIL home page