(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE40

ACCPU_3.PE40         Location/Qualifiers
FT   CDS_pept        43896..44306
FT                   /locus_tag="CAP2UW1_4608"
FT                   /gene_family="HOG000124752" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091545"
FT                   /db_xref="GeneID:8401980"
FT                   /translation="MARISTRKSVDVDYWRGRLEAARAFHKAAEDAITLAEPGSNANPA
FT                   ISQMVLAAIAYGDCLTARRANVINQQSHAAAPKLLRDVLGATLPTAQENRYRRILGHKD
FT                   ESQYGARSASVIHAQRLLDELQEFALWVEDQF"
FT                   /protein_id="YP_003165188.1"
     ATGGCGCGCA TCAGTACAAG AAAGTCCGTC GATGTCGACT ATTGGCGTGG GCGACTTGAA        60
     GCGGCTCGCG CCTTTCACAA AGCAGCCGAG GACGCCATCA CCCTGGCTGA ACCGGGATCC       120
     AATGCCAATC CGGCGATCAG TCAAATGGTC CTGGCAGCCA TTGCCTACGG CGACTGTTTG       180
     ACGGCAAGAC GAGCCAACGT CATCAACCAG CAAAGCCACG CAGCCGCACC CAAACTGCTG       240
     CGCGACGTGC TTGGGGCGAC CTTACCGACC GCGCAGGAAA ACCGCTATCG CCGCATACTG       300
     GGTCACAAGG ATGAATCCCA GTACGGCGCA CGCAGCGCGT CGGTCATCCA CGCCCAGCGT       360
     CTCCTGGATG AACTTCAGGA ATTTGCGCTC TGGGTCGAAG ACCAGTTTTA A                411
//

If you have problems or comments...

PBIL Back to PBIL home page