(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE41

ACCPU_3.PE41         Location/Qualifiers
FT   CDS_pept        complement(44819..45730)
FT                   /locus_tag="CAP2UW1_4610"
FT                   /gene_family="HOG000222463" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091546"
FT                   /db_xref="GeneID:8402098"
FT                   /translation="MSPVPEVIKVAERLRESARAKNAGRDVSSVFQEVVQLPLWEERVR
FT                   GLPNSFARSALFTSANRSVERENFKRRKIATLRGAEIFYTGEELRQDDGDVFLQIVHLA
FT                   RQQPLGDVVEFSGYALLKDLEWTTSKGSYERLRDSINRLSSTTVLVKTDGSAGHPEKGF
FT                   GGSLVRKFEWNADAERGTSQCWRIWLEPEIVVLFGRDTYTRIDWAQRLQLPPLAKWLHQ
FT                   FYFTHEKPIGYKVETIKTLCGSRIGVLAKFRYKLREALALLVEVGFIVSYDIDSRTDIL
FT                   NVVRAPRRIAVTDVIEGKCTKH"
FT                   /protein_id="YP_003165189.1"
     atgtcgcccg tacccgaagt gatcaaggtc gccgagaggt tgagggaaag cgccagggca        60
     aagaacgccg gccgggatgt gtcttccgtt ttccaggagg tggtccagct tccgctttgg       120
     gaggagcgcg ttcgcgggct gccgaattcg tttgcccgct ccgcgctctt tacgtcggcc       180
     aatcggagtg tcgagcgcga gaatttcaag cgccgcaaga tagcgaccct tcgcggggcc       240
     gagattttct acaccggcga agagttacgc caggacgacg gcgatgtgtt cctgcagatc       300
     gtccatctcg cgcgccagca gccgttgggg gatgtcgtcg agttctcggg ctacgccctg       360
     ctcaaagatc ttgaatggac aacgtcaaaa ggctcgtacg aacgtcttcg agacagcatc       420
     aaccgacttt cctctacaac cgtacttgtc aagaccgatg gttcagcagg ccatccggag       480
     aagggattcg gcggatcgct cgtgcgcaag ttcgaatgga atgccgacgc ggaacggggt       540
     acgtcccagt gctggcgcat ctggctggaa cctgagatcg ttgtcctctt cggccgtgat       600
     acctatacca ggatcgactg ggctcagcgt ctgcagttgc caccgcttgc caagtggctg       660
     caccagttct acttcacgca tgagaagccg atcggatata aagtcgagac gatcaagacg       720
     ctgtgcgggt ctcgcattgg cgttctggcg aagtttcgct acaaacttcg tgaggccctc       780
     gctctgctcg tcgaggtcgg attcattgtc tcgtacgaca tcgactcccg taccgacatc       840
     ctgaacgtcg tccgcgctcc gcgccggatc gcagtgaccg acgtgatcga aggcaagtgc       900
     accaagcact ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page