(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE42

ACCPU_3.PE42         Location/Qualifiers
FT   CDS_pept        complement(46640..47599)
FT                   /locus_tag="CAP2UW1_4611"
FT                   /gene_family="HOG000229116" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091547"
FT                   /db_xref="GeneID:8401982"
FT                   /translation="MAGQARKAAEAGDRFSRAEAVLDQRPTAFHQPSRDPAMVVSSKVA
FT                   AAGDKRSGRFERIPVDLIDANPYNARRIYRPQRIGELSESIVANGQMQPGIATMRDGGR
FT                   YVLVAGHYRLAAIRQAGLPTMDVMVHDGLSDRDLFEYSYRENSERDSQSALDDAMAWRE
FT                   MLDRNVYPNETALAGVVRKSLANVNRTLSILKLSGTVLDLVGQNPETFPMSCLSELVLL
FT                   EAVAGTKTALVFAEKVGQGEIGRKEIIEARMRIETPKSRKRKEISRQYKIHVSDGTQIG
FT                   ALKEWDSGRVSLDVVVSSAADRVALINELKKRFSIGDA"
FT                   /protein_id="YP_003165190.1"
     atggctgggc aggcgcgtaa ggctgcagag gctggcgacc ggttctcccg ggctgaagct        60
     gttctggatc aacggcccac ggcgttccac cagccgtcgc gggatccggc gatggtcgtg       120
     tcgtcgaagg tcgctgcggc aggggacaag aggagcgggc gtttcgagcg tatcccggtt       180
     gatctgatcg acgccaaccc gtacaacgcc cggaggattt atcgaccgca gcgaataggc       240
     gagctgtcgg agagcatcgt tgccaatggc cagatgcagc ctggaatagc tacgatgcgg       300
     gatggtggaa gatacgtgct ggtggccggt cactaccgcc tggccgcgat tcggcaagcc       360
     ggcctgccaa cgatggatgt gatggtgcac gatggcctct cggatcggga tctctttgag       420
     tacagctatc gggagaactc ggagcgtgat agccagtcgg ccctcgatga tgcgatggcc       480
     tggcgagaga tgctggaccg gaacgtgtat cccaatgaaa ctgccctcgc cggtgtggtc       540
     agaaaatcgc tggcaaacgt aaaccggacg ctctcgatcc tgaagctctc gggaacagtc       600
     ctcgatttgg tcggacagaa tccggagacg ttcccgatgt catgtctgtc ggaattggtt       660
     ctgcttgaag cagttgccgg aacgaaaaca gctcttgttt ttgcggaaaa ggttggacag       720
     ggcgagatcg gacgaaagga aatcatcgaa gccaggatga gaatcgaaac gccgaaaagc       780
     cgcaagagga aggaaatttc ccgacaatac aaaattcacg tttcggacgg aacacagatt       840
     ggggcgttga aagagtggga ttctggacgg gtgtcgctgg acgtcgtggt gtcgtcggct       900
     gccgatcgcg ttgcactgat caacgagctg aaaaagcgat tctcgattgg tgatgcttga       960
//

If you have problems or comments...

PBIL Back to PBIL home page