(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE43

ACCPU_3.PE43         Location/Qualifiers
FT   CDS_pept        complement(47611..48318)
FT                   /locus_tag="CAP2UW1_4612"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091548"
FT                   /db_xref="GeneID:8401983"
FT                   /translation="MAKILTVFNQKGGCGKTMTAMQLAGTCAMRGYSTLVVDMDSQGTA
FT                   LVWSTVKPDPQLRLKATGFPAKVESFAPLGRGMVRPVADLAPLYDLIIIDTPPAVASEA
FT                   PWAALQISDLALIPFVPTAADMWAKEARVLARKAMEQNPDIRGVHHLPSMVRRGNTIAG
FT                   VLDQFRSDPEVALLSSTVSLLNAYLDSQMLGLCVGQLSSSSTAAKEMSALSDEVLGLLG
FT                   LSKSVEGKRKGKR"
FT                   /protein_id="YP_003165191.1"
     atggcaaaga ttcttacggt gttcaatcag aagggtggtt gtggcaagac aatgactgcg        60
     atgcagcttg ctggcacgtg cgccatgcgc gggtattcga cgctggtggt tgacatggat       120
     tcccagggaa cggcattggt gtggtcgacc gttaagcccg atccgcaatt gaggctcaag       180
     gcgacagggt ttccggcaaa ggtggaatcg ttcgcgccgc ttgggcgtgg aatggttcgc       240
     ccggtggctg acttggcacc cctctacgat ctcatcatca ttgatacgcc cccggcggtg       300
     gcttcggagg caccatgggc cgctctacag atttccgatt tggcactgat cccgttcgtt       360
     ccaacggctg cggacatgtg ggcgaaggaa gcccgtgtac tcgccaggaa ggctatggag       420
     cagaacccgg atatccgcgg agtccatcat ctgccgtcga tggtccggcg gggaaacacg       480
     atcgctggcg tgctcgatca gtttcgaagt gacccggagg tcgccctgct cagttcgacc       540
     gtcagccttc tcaatgccta cctggactcg cagatgcttg gtttgtgtgt gggacagctg       600
     tcgagttcgt cgaccgcggc gaaggaaatg tcggcgcttt ctgacgaagt cctcggcctg       660
     ctcggcttat cgaagtcggt ggaaggtaaa cgaaagggta agcgatga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page