(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE44

ACCPU_3.PE44         Location/Qualifiers
FT   CDS_pept        49344..49664
FT                   /locus_tag="CAP2UW1_4613"
FT                   /gene_family="HOG000229826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091549"
FT                   /db_xref="GeneID:8401984"
FT                   /translation="MTNIIQFPKSDSSAHDLAPLKLQARPIDGPGGGRILSNLVKVVWV
FT                   ATVLMWPVMKWVLSFDVLFQFFRMLYHWSTPGVYATWTFFLHFSALVLLTCFVSLYKPR
FT                   GI"
FT                   /protein_id="YP_003165192.1"
     ATGACGAACA TCATTCAGTT TCCCAAGAGC GATTCTTCTG CTCACGATCT GGCTCCCCTG        60
     AAGCTCCAAG CCAGACCGAT AGATGGCCCT GGAGGAGGGC GGATTCTCTC CAACCTCGTC       120
     AAAGTCGTTT GGGTTGCCAC CGTGCTGATG TGGCCAGTGA TGAAGTGGGT CTTGTCTTTC       180
     GACGTCTTGT TCCAGTTTTT CCGCATGCTT TACCACTGGA GCACGCCAGG GGTGTACGCC       240
     ACCTGGACGT TCTTCCTCCA CTTCTCCGCG TTGGTTCTAC TCACCTGTTT CGTATCGCTA       300
     TACAAGCCAA GAGGGATTTA G                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page