(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE45

ACCPU_3.PE45         Location/Qualifiers
FT   CDS_pept        49879..50184
FT                   /locus_tag="CAP2UW1_4614"
FT                   /gene_family="HOG000113242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091550"
FT                   /db_xref="GeneID:8401985"
FT                   /translation="MKKRLTERQFQEAIKGLDVGAQTLEIARGVLIDGKPQKEFATALG
FT                   LSRGAISQAVNRVWAAHDERNLPAGYVRVSAILPEHRAFIVKKWAEDATKKRQHKK"
FT                   /protein_id="YP_003165193.1"
     ATGAAGAAAC GGCTAACCGA ACGCCAATTC CAGGAAGCCA TCAAAGGGCT GGATGTGGGA        60
     GCGCAAACCC TGGAGATCGC GCGCGGTGTC CTGATCGATG GCAAGCCGCA AAAGGAGTTT       120
     GCCACGGCGC TCGGCTTGTC CCGCGGCGCG ATTTCGCAGG CGGTCAATCG GGTCTGGGCG       180
     GCACACGACG AAAGGAATCT CCCGGCGGGC TACGTGCGGG TCTCGGCAAT CCTGCCGGAA       240
     CATCGGGCAT TCATCGTAAA AAAATGGGCT GAGGACGCCA CGAAAAAGCG GCAACACAAG       300
     AAATGA                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page