(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE46

ACCPU_3.PE46         Location/Qualifiers
FT   CDS_pept        50189..50971
FT                   /locus_tag="CAP2UW1_4615"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091551"
FT                   /db_xref="GeneID:8401986"
FT                   /translation="MKTLVVANQKGGVGKTSTLVHLAFDFLERGLKVVVIDLDTQANAS
FT                   YTLQSFRSNLVASELFAAVPSSAWPQTATDFTDPNTQRMTLIGSDIGLANLEKKMSLAE
FT                   AGANFREAIKTVEGQGFDVCLIDTAPSLGVTMAAALLAADYVLSPIELEAYSIQGIKQM
FT                   VTTIAHLRKANHKLKFLGMVPSKVDARNPRHARHLEELERAYPQLMIPTGVGLRSSIAD
FT                   ALASRVPVWKIRKTAARKATQEIRALAAHVFEKMEMTQ"
FT                   /protein_id="YP_003165194.1"
     ATGAAAACAC TGGTTGTCGC GAACCAGAAG GGCGGGGTTG GCAAGACTTC GACCCTCGTT        60
     CACCTCGCGT TCGACTTCCT GGAGCGAGGT CTGAAGGTGG TCGTCATCGA TCTCGACACC       120
     CAGGCCAACG CCTCATACAC GCTTCAATCC TTCCGATCCA ACCTCGTCGC CAGCGAACTG       180
     TTTGCCGCCG TACCATCCAG CGCGTGGCCG CAGACTGCAA CCGACTTCAC CGATCCCAAT       240
     ACCCAGCGCA TGACCCTGAT CGGGTCCGAC ATCGGCTTGG CGAACCTGGA GAAGAAGATG       300
     TCCCTGGCCG AGGCCGGCGC GAACTTCCGC GAGGCTATCA AGACCGTAGA AGGGCAGGGC       360
     TTCGACGTCT GCCTGATCGA CACCGCTCCT TCTCTTGGCG TTACGATGGC CGCCGCTCTG       420
     CTCGCGGCCG ACTACGTTCT CTCGCCGATC GAACTTGAGG CTTACAGTAT CCAGGGCATC       480
     AAGCAGATGG TCACGACCAT TGCCCATCTT CGCAAAGCCA ATCACAAGCT CAAGTTCCTT       540
     GGCATGGTCC CCAGCAAGGT CGATGCTCGC AACCCGCGTC ACGCTCGCCA CCTGGAAGAG       600
     CTCGAACGTG CCTACCCGCA ACTGATGATC CCGACCGGGG TCGGGCTGCG CAGCAGCATT       660
     GCCGACGCGC TGGCGTCCCG CGTGCCGGTG TGGAAGATCA GGAAGACCGC CGCCCGCAAG       720
     GCCACGCAGG AAATCCGCGC ACTGGCCGCC CATGTTTTCG AGAAAATGGA GATGACACAA       780
     TGA                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page