(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE47

ACCPU_3.PE47         Location/Qualifiers
FT   CDS_pept        50968..52008
FT                   /locus_tag="CAP2UW1_4616"
FT                   /gene_family="HOG000229828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091552"
FT                   /db_xref="GeneID:8401987"
FT                   /translation="MTTATHPATTAKKKPEAGPPASGLDLESIGDLSDLLNQPETVARS
FT                   FRPLELPLDLIDEDPHQPRTKDNPGFLPESLEELARTIRLRGVKTPISVRDNPDAAGRY
FT                   LINHGARRARASRLVYKTTIPAFVDNDYNEADQVIENLQRNELIPREIADFIGRELAKG
FT                   KKKGDIAKELGKSPAFVSQHVTLLDLPDPIAEAFNSGRCRDVTVINELVTAHKKARNEV
FT                   GLWLADDTQEITRGSVKLLREYLDDKRQHEDDERNSGTAESTASARAEAGAGEQATHSR
FT                   RNPKEADPDRLRRAIVHVQHDGRPARLILNRRPPVEGHAWLKYDDDGHELAADLAQVQL
FT                   VALLEG"
FT                   /protein_id="YP_003165195.1"
     ATGACCACCG CCACGCATCC CGCCACCACC GCTAAGAAGA AGCCCGAGGC GGGGCCACCG        60
     GCGTCCGGTC TGGATCTGGA GAGCATCGGC GATCTCTCTG ACCTTCTCAA CCAGCCAGAG       120
     ACCGTCGCGC GAAGTTTCCG GCCGCTGGAA CTGCCCCTGG ACCTGATTGA CGAAGATCCG       180
     CATCAGCCTC GAACAAAGGA CAACCCTGGC TTCTTGCCGG AAAGCCTTGA AGAACTGGCT       240
     CGAACCATCC GCTTGCGTGG CGTCAAGACC CCCATTTCGG TGCGTGACAA CCCGGATGCC       300
     GCCGGCCGCT ACCTCATCAA CCACGGTGCC CGCCGCGCCC GTGCATCCAG GCTCGTCTAC       360
     AAGACAACCA TCCCTGCCTT CGTCGACAAC GATTACAACG AGGCCGACCA GGTCATCGAA       420
     AATCTGCAAC GCAACGAACT GATCCCGCGC GAGATCGCCG ACTTCATCGG CCGCGAACTG       480
     GCGAAGGGCA AGAAGAAGGG TGACATTGCG AAGGAGCTCG GCAAGTCCCC GGCCTTCGTA       540
     TCGCAGCACG TCACCTTGCT GGACCTCCCC GATCCGATTG CCGAAGCCTT CAACTCCGGC       600
     CGCTGCCGTG ACGTGACCGT GATCAACGAG CTCGTCACTG CACACAAAAA AGCGCGCAAC       660
     GAAGTCGGTC TCTGGTTGGC CGACGATACC CAGGAGATCA CGCGCGGATC GGTCAAGCTG       720
     CTGCGCGAGT ACCTCGACGA CAAGCGCCAG CACGAGGACG ACGAGCGCAA TTCCGGCACG       780
     GCCGAGAGTA CCGCAAGCGC CCGCGCAGAA GCAGGGGCGG GCGAGCAAGC TACCCACTCC       840
     AGGAGGAACC CGAAGGAAGC CGACCCGGAC AGGTTGAGAA GGGCCATCGT GCATGTGCAG       900
     CATGACGGCC GTCCGGCTCG CCTGATTCTG AATCGCCGGC CACCGGTCGA GGGCCACGCC       960
     TGGTTGAAGT ACGACGATGA CGGCCACGAG CTCGCTGCCG ATCTCGCCCA GGTGCAGCTT      1020
     GTCGCTCTTC TGGAAGGATA A                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page