(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE48

ACCPU_3.PE48         Location/Qualifiers
FT   CDS_pept        52165..53007
FT                   /locus_tag="CAP2UW1_4617"
FT                   /gene_family="HOG000229829" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091553"
FT                   /db_xref="GeneID:8401988"
FT                   /translation="MELNKDIRDRILSAADALYEQAGRTSFPTVDSVRKVAKVNMNDAA
FT                   ATMKEWRRAQTAQAAPVAITVPEAVHQLHSQALAALWQSAQNTANESLRAAQAGWEAER
FT                   AEADTINKQLGDAYDAQGVELEAANRRIDELTAKCQHEQQRSTELVQHIEETRKATLVA
FT                   ENRAAIAEQRAVEIERRAADLRAELDLAHQDATQTRTELADLRQAQQEQRKTAAQEALR
FT                   AAERLTATQAERDESRKEAAKAREETAHWRGQVEALKEQQMGFLEAIKTGKKPSRAGE"
FT                   /protein_id="YP_003165196.1"
     ATGGAATTGA ACAAGGACAT CCGCGATCGC ATTCTCTCTG CGGCCGATGC GCTCTATGAG        60
     CAGGCAGGTC GCACCTCCTT TCCGACGGTG GACTCGGTTC GCAAGGTGGC CAAAGTCAAC       120
     ATGAACGATG CCGCCGCTAC CATGAAGGAA TGGCGACGTG CGCAGACCGC CCAGGCGGCG       180
     CCGGTAGCCA TCACTGTTCC GGAAGCCGTC CACCAACTCC ATAGTCAGGC GCTGGCCGCC       240
     TTGTGGCAGT CCGCCCAGAA CACCGCAAAC GAGTCACTGC GCGCCGCGCA AGCCGGCTGG       300
     GAGGCCGAAC GCGCCGAGGC CGACACCATC AACAAGCAAC TTGGCGACGC CTACGACGCC       360
     CAGGGGGTCG AACTGGAGGC CGCCAATCGC CGAATCGACG AACTGACCGC CAAGTGCCAG       420
     CACGAGCAGC AGCGAAGCAC CGAACTCGTG CAACACATCG AGGAAACGCG GAAGGCCACA       480
     CTGGTCGCCG AGAACCGGGC GGCCATTGCC GAGCAGCGTG CCGTCGAGAT CGAACGCCGC       540
     GCCGCCGACT TGCGGGCCGA ACTTGACCTC GCGCATCAGG ATGCTACCCA GACGCGAACA       600
     GAACTGGCTG ACCTCCGTCA GGCCCAGCAA GAGCAACGCA AGACCGCCGC CCAGGAGGCT       660
     CTCCGCGCCG CCGAACGCCT CACTGCCACG CAGGCCGAGC GCGACGAGTC TCGCAAGGAA       720
     GCTGCCAAGG CCCGCGAGGA AACCGCCCAT TGGCGTGGTC AGGTCGAGGC GTTGAAGGAG       780
     CAGCAGATGG GCTTTCTGGA GGCGATCAAA ACCGGCAAGA AGCCGAGCAG GGCAGGGGAG       840
     TGA                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page