(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE52

ACCPU_3.PE52         Location/Qualifiers
FT   CDS_pept        56285..57295
FT                   /locus_tag="CAP2UW1_4621"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091557"
FT                   /db_xref="GeneID:8401992"
FT                   /translation="MDDPSQVIQCSNPDCKIAETGKCVEGLDPSACGNYGKPLRVLDIA
FT                   PEAEEGAGPQMVSLPHADRLAPGEARDLLPEARARVIAIVGPHDSGKTSLIASLYDQLQ
FT                   EGPIVPFAFRGSQTLHAFEQACHDARAASQRGTPHSERTRRGEVRFFHLGLLHQESGEA
FT                   LNLLLGDRAGEEYREAGDDMTLAAEFIEVERSDVLTLLVDGKRLAQDGHRHNAREELLL
FT                   IVQALKDAEILPNGARLAIVLTKFDAVMASPNAKRVGADLATAVARLNAYFADCFAKIE
FT                   VFRVAASPTEHGVARGTGVAELLCFWLADVSPTSLPHTLQVLPERVIARLAEVGV"
FT                   /protein_id="YP_003165200.1"
     ATGGACGACC CGAGTCAAGT CATTCAATGC AGCAACCCGG ACTGCAAGAT CGCCGAAACG        60
     GGCAAGTGCG TTGAGGGTCT TGATCCCTCG GCATGCGGCA ACTATGGCAA GCCGTTGCGG       120
     GTCCTGGATA TTGCACCGGA GGCGGAAGAG GGTGCAGGTC CACAGATGGT CTCGTTGCCG       180
     CACGCGGATC GCCTCGCGCC CGGTGAAGCA CGCGACCTAC TTCCGGAAGC CCGTGCGCGC       240
     GTCATTGCGA TTGTGGGGCC GCATGACTCA GGCAAGACAA GCCTGATAGC CAGCCTGTAC       300
     GATCAATTGC AGGAGGGGCC AATCGTGCCG TTCGCATTTC GTGGTTCGCA AACCCTGCAT       360
     GCCTTTGAGC AAGCTTGTCA TGATGCGCGA GCGGCATCCC AGCGTGGGAC TCCGCACAGC       420
     GAGCGCACCA GGCGAGGCGA GGTGCGCTTC TTCCATCTTG GATTGCTGCA TCAAGAGTCG       480
     GGCGAGGCAC TGAATCTGCT GCTCGGCGAT CGGGCAGGAG AGGAGTATCG CGAGGCCGGC       540
     GATGACATGA CATTGGCCGC GGAGTTCATC GAAGTCGAGC GGTCGGATGT TCTGACGCTC       600
     TTGGTTGACG GCAAGCGCTT GGCTCAAGAC GGCCACCGGC ATAACGCGCG TGAGGAACTG       660
     CTGCTGATTG TGCAAGCGCT CAAGGATGCG GAGATCCTCC CTAATGGTGC ACGCCTAGCC       720
     ATTGTGCTGA CCAAGTTTGA TGCGGTGATG GCTTCACCGA ATGCGAAGCG TGTGGGGGCT       780
     GATCTTGCGA CAGCAGTTGC CCGCCTTAAC GCGTATTTCG CTGATTGCTT TGCGAAGATT       840
     GAGGTCTTTC GAGTTGCCGC ATCACCAACT GAACACGGGG TGGCGCGAGG TACCGGGGTC       900
     GCTGAATTGC TGTGCTTTTG GCTTGCGGAC GTGTCGCCGA CATCTCTGCC GCATACATTG       960
     CAAGTATTGC CGGAGCGAGT CATTGCGCGT CTTGCGGAGG TTGGAGTCTA G               1011
//

If you have problems or comments...

PBIL Back to PBIL home page