(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE53

ACCPU_3.PE53         Location/Qualifiers
FT   CDS_pept        57298..58014
FT                   /locus_tag="CAP2UW1_4622"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091558"
FT                   /db_xref="GeneID:8401993"
FT                   /translation="MMQQSVVVLGLPGSGKTTFLAALWHLVFSRETETKLRFGSLKSGN
FT                   VKHLNAIAARWRSAQMQERTLLAGNQFVSINLVTDDSQAVTITFPDIAGESYRQMWEER
FT                   ECEKVVAETLTQGSVLLFVHADDIKRPLWIMDVAAMALALDLPPDEVAQPVPWQPRLAP
FT                   TQVQLVGLLSLLGAAPLDIGPRRLVVMLSAWDKAKGERLAPREFLRAKLPLLSQYLDTN
FT                   PKLWQWTVSMAVKKRR"
FT                   /protein_id="YP_003165201.1"
     ATGATGCAGC AATCCGTTGT GGTCCTCGGC CTTCCTGGGA GTGGCAAGAC CACCTTCTTA        60
     GCGGCGTTGT GGCACCTCGT ATTCAGTCGT GAAACCGAGA CCAAACTGCG CTTTGGCAGC       120
     CTGAAGAGCG GCAACGTCAA GCATTTGAAC GCCATAGCAG CGCGGTGGCG GAGTGCACAG       180
     ATGCAAGAGC GAACGCTGCT CGCGGGCAAT CAGTTCGTCA GCATCAACTT GGTGACGGAT       240
     GACAGCCAAG CGGTCACCAT CACGTTCCCG GACATCGCAG GGGAGTCATA TCGGCAGATG       300
     TGGGAAGAGC GCGAGTGCGA GAAAGTGGTT GCCGAGACGC TGACGCAAGG CAGCGTGTTG       360
     CTCTTCGTTC ACGCAGACGA CATCAAGCGT CCGCTGTGGA TCATGGATGT TGCCGCCATG       420
     GCGCTCGCGC TGGACTTGCC GCCGGACGAA GTTGCACAGC CCGTGCCATG GCAACCTCGT       480
     CTGGCGCCCA CACAAGTGCA GTTGGTGGGA CTGCTGAGCC TCCTCGGCGC AGCACCGCTG       540
     GACATTGGGC CACGGCGCCT TGTTGTGATG CTTTCCGCTT GGGATAAAGC GAAGGGCGAA       600
     CGTCTTGCGC CACGTGAGTT TCTTCGCGCA AAGCTGCCCT TGCTCTCGCA GTACCTAGAT       660
     ACGAATCCGA AGCTTTGGCA GTGGACGGTG TCAATGGCGG TCAAGAAGCG CCGATAA          717
//

If you have problems or comments...

PBIL Back to PBIL home page