(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE54

ACCPU_3.PE54         Location/Qualifiers
FT   CDS_pept        complement(57998..58630)
FT                   /locus_tag="CAP2UW1_4623"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091559"
FT                   /db_xref="GeneID:8401994"
FT                   /translation="MRHILLTQPVTAVSFGMLEAASSALLVAAAGFLDASAACRLRAAS
FT                   GAIDLAPVAAAADDDLGSTAMAQEESAGGFHWRFRLRQRAIDRKRPLVKYSPCTRAQHG
FT                   VGHDIGVDFAGLAGVVPVLLGGSFLPHRERACHPRLAPLAASAAGFPDGHRAAGGRVSS
FT                   RPSGSFRRALLPHHRSPRRPKTPIRLDHGPSLPGHILHRSQPVIGAS"
FT                   /protein_id="YP_003165202.1"
     atgcgtcaca ttctgctgac gcagccggta acggcggttt ctttcggcat gcttgaggcg        60
     gcctcttcgg ctcttctggt agcggcggcc ggcttcctgg acgcaagcgc ggcgtgccgc       120
     ctgcgcgcag ccagcggcgc aatagatctg gccccggtcg cagcggctgc agacgacgac       180
     ctgggttcga cagcgatggc acaggaagaa tcggccggtg gcttccattg gcggttccgc       240
     ttacgccaac gagctatcga caggaagagg ccgctcgtga aatactctcc ctgcacccgt       300
     gcccagcacg gtgtggggca cgacatcggt gtggactttg cgggtttggc cggtgtcgtg       360
     cccgttctcc tcggcgggtc ctttttaccg catcgcgaac gggcttgtca tccccgcctg       420
     gcccccttgg ccgcatccgc ggcaggtttc cccgatggcc accgcgcggc aggagggcgc       480
     gtctccagtc gcccttcggg ctccttccga cgcgccctcc tgccgcacca tcggtcgccc       540
     agacgcccca aaacccccat ccgtctcgac cacggaccgt ccctccccgg tcacatcctc       600
     caccgctcgc agccagttat cggcgcttct tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page