(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE55

ACCPU_3.PE55         Location/Qualifiers
FT   CDS_pept        complement(59550..61628)
FT                   /locus_tag="CAP2UW1_4625"
FT                   /gene_family="HOG000228685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091560"
FT                   /db_xref="GeneID:8402099"
FT                   /translation="MMGEQHAKIQARHLKRNAYLYVRQSTLRQVLENSESTKRQYDLRE
FT                   RALALGWRLDQVVVIDSDLGQSGASAVDREGFQRLVSEVGLGRAGIVMGLEVSRLARNS
FT                   TDWHRLLEICALADTLILDEDGVYDPAHFNDRLLLGLKGTMSEAELHVLQARLRGGILN
FT                   KARRGELEIRLPIGFDYDPAGRVRLDPDVRVQESLRQFFRTFRRTGSATATVKAFRAEG
FT                   LSFPHRIYRGPQTGELLWTDLEHSRALWLLHHPRYTGAFCFGRTRVRKQPDGSHRHQRL
FT                   PSEEWIALIRDAHAGYITWDEYEENLRILRDNAQAPATGRDRGTPREGPALLQGLALCA
FT                   KCGDRMTVRYHVNGTRRVPDYVCQREGVEHAQPICQQIVGGELDAAIGRLLVEVVTPIT
FT                   LGVALAVQKELESRSEDSDRLRRQAVERARYESDLARRRYMRCDPDNRLVADSLEVEWN
FT                   QALRNQTAAQEHYDKQRESETGLDDQQRAAILALAKDFPRLWNDPHTADRERKRMARLL
FT                   IADVTLLKEADIRAQVRFSGGATHTLHLPLPKPAWMLRQTPGTVVAEIDRLLEDHTDSE
FT                   IADWLNDQGLISGDGKPFHRPMVRRIRIDYALPSRHDRLRARGLLTLHEMAQRLNICPD
FT                   SLKRWRRAGLLKAHKYDDRGGYLFEPPGPDTPVKHQHQGKTTGKSTTREGSFPAHTA"
FT                   /protein_id="YP_003165203.1"
     atgatgggtg agcagcacgc aaaaatacag gcgcgacacc tgaagagaaa tgcctatctc        60
     tacgtgcggc agtcgacgtt gcgccaggtg ctcgagaaca gcgagagtac caagcgccag       120
     tacgatttgc gcgagcgggc cctggcactg ggctggcgtc tcgatcaagt cgtcgtcatt       180
     gactccgatc tcggccagtc cggggcgagt gcggtggatc gcgaaggctt ccagcgactg       240
     gtcagcgagg tcggtctggg gcgggcgggg atcgtcatgg gcctggaagt gtcgcgtctg       300
     gcgcgcaact cgacggactg gcaccgcctg ctggagatct gcgctttggc ggacacgctg       360
     atcctcgacg aagacggtgt gtacgacccg gcgcacttca atgatcgctt gctgctcggc       420
     ctgaagggta cgatgagcga ggccgaactg cacgttttgc aggcccggct gcgcggtggc       480
     atcctcaaca aggctcgccg cggcgaactc gagattcggc tgccgatcgg atttgattac       540
     gatccggccg ggcgcgtgcg gctggatccc gatgtccgcg ttcaggaaag cctgcggcag       600
     ttcttccgca ccttccggcg tacgggttcg gcaacggcga cggtcaaggc ctttcgtgcc       660
     gaagggctga gcttcccgca ccggatttac cgcggaccgc agactggcga gctgttgtgg       720
     actgatctcg aacactcgcg cgcgctctgg ctcctgcatc atccgcgcta taccggtgcc       780
     ttttgctttg ggcggacgcg cgtgcgcaag cagcccgatg gttctcatcg ccatcaacgg       840
     ctgccatccg aggaatggat cgcgctgatt cgtgatgccc atgctggata cattacttgg       900
     gacgagtacg aagagaacct ccggatcctg cgcgacaatg cgcaggcacc tgccaccggg       960
     cgtgatcggg gcacgccgcg tgaaggcccg gcgttgctgc aaggattggc cctctgcgcc      1020
     aaatgtggtg atcgcatgac cgttcgctat catgtgaacg gcacacggcg cgtgccggat      1080
     tatgtttgtc agcgcgaggg ggtcgagcat gcgcagccga tctgccagca gattgtcggt      1140
     ggcgaactcg acgcggccat tggccgcttg ctggtggagg tcgtgactcc gatcaccctg      1200
     ggggtggcgc tggcggtgca gaaagaactg gagagccgaa gcgaagacag tgaccgcttg      1260
     cgccgtcaag ccgtcgagcg ggcgcgctac gagtccgatc tggcacgccg ccgttatatg      1320
     cgttgtgatc ccgacaaccg tctggtcgcc gattcgctgg aagtggaatg gaaccaggcg      1380
     ctgcgcaacc agacggcggc ccaggagcac tacgacaaac agcgcgagag cgagaccggg      1440
     ctcgatgacc agcagcgcgc cgccatcctt gcgctggcga aagacttccc acgcctgtgg      1500
     aacgatcccc atacggctga ccgggagcgc aagcggatgg cccggttgct gatcgcggat      1560
     gtcaccttgc tcaaagaggc cgacatcagg gcgcaagtac gcttcagcgg tggtgcgacg      1620
     cacacgctgc acctcccgct gcccaagcca gcctggatgc tgcgccagac gccaggcacc      1680
     gtggtcgccg agattgaccg actcctcgaa gatcacaccg atagtgaaat cgcggactgg      1740
     ctcaacgacc aaggcttgat ctccggcgac ggcaagccct tccaccgccc gatggttcgt      1800
     cgtatccgga tcgactatgc gctgcccagt cgccacgatc ggctgcgcgc gcgtggcttg      1860
     ctgaccctgc atgaaatggc acagcgtctc aacatctgtc cggacagcct caagcgttgg      1920
     cggcgcgccg gcctgctcaa ggcccacaag tatgacgaca ggggcggcta cctcttcgaa      1980
     ccgcctggtc ctgacacgcc ggtcaagcat caacatcaag gcaaaaccac aggcaaatca      2040
     accacccgcg agggaagttt ccccgcacat accgcatga                             2079
//

If you have problems or comments...

PBIL Back to PBIL home page