(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE56

ACCPU_3.PE56         Location/Qualifiers
FT   CDS_pept        complement(61625..61909)
FT                   /locus_tag="CAP2UW1_4626"
FT                   /gene_family="HOG000158241" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091561"
FT                   /db_xref="GeneID:8401996"
FT                   /translation="MKPTLMTDGQTLAEGYESLRQETAERPGGRHRSPGRALFLFKGMA
FT                   AWMRGVSETAPSPAAAALRNESRLPAGMEQHLINLVASMALATARESRP"
FT                   /protein_id="YP_003165204.1"
     atgaagccga cgctgatgac cgatggccag accttggccg agggttacga gtccttgcgg        60
     caagagaccg ccgagaggcc cggcggccgt caccgctcgc ccgggcgtgc actcttcctg       120
     ttcaaaggga tggcggcctg gatgcgtggc gtcagcgaaa cggccccgag tccggccgcc       180
     gccgctctgc gcaatgagtc gaggttaccg gcggggatgg aacagcacct gatcaatctg       240
     gtcgccagca tggcgctggc gacggcacgg gagagtaggc catga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page