(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE57

ACCPU_3.PE57         Location/Qualifiers
FT   CDS_pept        complement(61906..62373)
FT                   /locus_tag="CAP2UW1_4627"
FT                   /gene_family="HOG000026445" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091562"
FT                   /db_xref="GeneID:8401997"
FT                   /translation="MIPPSKPDPKLLALAESGTVNPHAQDVQDAAFLDSEFFDPRDLVQ
FT                   VRYEMLRRVRTEGQTVVDAASSFGVSRPTFYKAQADFERAGLAGLLPVKRGPHGPHKIT
FT                   DEVMAFIEAARAQEEGLDAQELVERIAEHFGLAVHRRTVDRALARSKKKRR"
FT                   /protein_id="YP_003165205.1"
     atgatcccgc cctcgaagcc cgaccccaaa ctcctcgctc tcgccgagag cggaaccgtg        60
     aatccgcacg cgcaggacgt tcaggatgcc gcctttctcg acagcgagtt cttcgatccg       120
     cgggacttgg tacaggtgcg ttacgagatg ctgcgtcgtg tacgcaccga aggtcagacc       180
     gttgtcgatg ccgccagcag cttcggcgtc tcccggccga ccttctacaa ggcccaggca       240
     gatttcgaac gcgcgggtct cgccggactg ttgccggtca agcgagggcc gcacggaccg       300
     cacaagatca ccgacgaggt catggccttc atcgaggcgg cacgtgccca ggaagaagga       360
     ctggacgcac aggagttggt ggagcggatc gcagagcact tcggactggc cgtccatcgg       420
     cgcacggtcg accgcgcgct ggcacggagc aaaaaaaaac gccgatga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page