(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE58

ACCPU_3.PE58         Location/Qualifiers
FT   CDS_pept        63683..64444
FT                   /locus_tag="CAP2UW1_4629"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091563"
FT                   /db_xref="GeneID:8402100"
FT                   /translation="MIPSEALRKRAEALHLHGLLAHWSELAECVWVEPLLTWEETERAR
FT                   RSLERRLAEAHIGRFKPLADFDWDWPEQCDRTAISELMSLEFLKSASNAILVGASGLGK
FT                   STIARNIAHRAVLSGHTVLFTTAGQLLGDLAAIDSDSVLRRRLRHYAAPALLVIDEVGY
FT                   LSYSNRHADLLFELINRRHECRSTLITTNRSFSEWSEVFPNAACTVALIDRLVHHAEII
FT                   AIKGESYRRKEAQERAEQRARKRRSTVGAAA"
FT                   /protein_id="YP_003165206.1"
     ATGATCCCGA GTGAGGCCTT GCGCAAACGG GCGGAAGCCC TGCATCTGCA CGGCTTGCTG        60
     GCGCATTGGT CGGAGCTGGC CGAGTGCGTT TGGGTCGAGC CCTTGCTGAC CTGGGAGGAG       120
     ACCGAACGGG CCAGGCGCAG TCTGGAGCGC CGTCTCGCCG AGGCGCACAT CGGTCGCTTC       180
     AAGCCGCTCG CGGATTTCGA TTGGGACTGG CCGGAGCAGT GCGATCGGAC AGCGATCAGC       240
     GAGTTGATGA GCCTGGAGTT CCTGAAGAGC GCGAGCAATG CCATCCTGGT CGGGGCGAGT       300
     GGGCTGGGCA AGTCGACGAT CGCCCGCAAC ATTGCGCACC GAGCGGTCCT GTCCGGGCAT       360
     ACGGTGCTGT TCACCACCGC CGGTCAGCTC CTCGGCGACC TGGCAGCGAT CGACAGCGAT       420
     TCGGTTCTGC GCCGGCGATT GCGTCACTAT GCGGCGCCGG CGCTGCTGGT GATCGACGAG       480
     GTCGGCTATC TGTCGTATTC GAACCGCCAC GCCGACCTGC TCTTCGAGCT GATCAACCGG       540
     CGCCACGAGT GCCGCAGCAC GCTGATTACA ACCAACCGTT CGTTCTCCGA GTGGTCGGAG       600
     GTCTTCCCCA ATGCGGCCTG TACCGTCGCC CTGATCGATC GTCTCGTTCA TCACGCCGAG       660
     ATCATCGCCA TCAAGGGGGA ATCCTATCGT CGCAAGGAGG CTCAGGAGCG GGCGGAGCAG       720
     CGGGCCCGCA AACGTCGATC CACCGTCGGA GCTGCCGCAT GA                          762
//

If you have problems or comments...

PBIL Back to PBIL home page